KEGG   Mycobacterium bovis BCG Tokyo 172: JTY_0168Help
Entry
JTY_0168          CDS       T00864                                 

Gene name
adhE1
Definition
zinc-type alcohol dehydrogenase e subunit (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
mbt  Mycobacterium bovis BCG Tokyo 172
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mbt00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    JTY_0168 (adhE1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    JTY_0168 (adhE1)
  Lipid metabolism
   00071 Fatty acid degradation
    JTY_0168 (adhE1)
  Amino acid metabolism
   00350 Tyrosine metabolism
    JTY_0168 (adhE1)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    JTY_0168 (adhE1)
   00626 Naphthalene degradation
    JTY_0168 (adhE1)
Enzymes [BR:mbt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     JTY_0168 (adhE1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(192214..193365)
Genome map
AA seq 383 aa AA seqDB search
MPAVQPWLYSNMPAIRGAVLDQIGVPRPYWRSKPISVVELRLDPPDRGEVLVRIEAAGVC
HSDLSVVDGTRVRPVPILLGHEAAGIVEQVGDGVDGVAVGQRVVLVFLPRCGQCAACATD
GRTPCEPGSAANKAGTLLGGGIRLSRGGRPVYHHLGVSGFATHVVVNRASVVPVPHEVPP
TVAALLGCAVLTGGGAVLNVGDPQPGQSVAVVGLGGVGMAAVLTALTYTDVRVVAVDQLP
EKLSAAKALGAHEIYTPQQATAGGVKAAVVVEAVGHPAALHTAIGLTAPGGRTITVGLPP
PDVRISLSPLDFVTEGRSLIGSYLGSAVPSHDIPRFVSLWQSGRLPVESLVTSTIRLDDI
NEAMDHLADGIAVRQLISFTGDL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
gtgccggcagtgcagccatggttgtattccaacatgcctgccatccggggcgcggtgcta
gaccagatcggtgtgccgcggccctattggcggtcgaaaccaatcagcgtcgtcgagctg
cgcctggacccgcccgaccgcggtgaggtccttgtccgaatcgaggctgcgggcgtgtgc
cactccgacctgtcggtggtcgacggcacccgggtacggccggtgccgatcttgctcggt
catgaagccgctggaatcgtcgagcaggtcggcgacggcgtcgacggggtcgcggtcggt
cagcgagtcgtgctggtgttccttccgcgttgcggccagtgcgcggcgtgcgcgaccgac
ggtcggacgccgtgcgaaccgggcagcgcggccaacaaggccggcacactgctcggtggc
ggtatccggctcagccggggcggccgcccggtgtaccaccacctcggcgtctcgggtttc
gcgacccatgtcgtcgtcaaccgggccagcgtggttccggtgccgcacgaggtgccgccc
accgtcgctgccctactcgggtgcgcggtgctcaccggtgggggtgcggtactcaacgtc
ggtgatccgcagcccggccagtcggtcgccgtcgtcggcctcgggggcgtcggtatggca
gcggtgctcaccgctttgacgtatacagacgttcgtgtggtcgccgtcgatcagctaccc
gaaaagctgtcggccgcaaaggccttgggcgcccatgagatctacacaccgcagcaggcc
acggccggcggggtcaaagccgccgtggttgtcgaagccgtcggtcatcctgccgcgctg
cacaccgcgatcgggcttaccgcgcccggagggcgcaccatcaccgtcgggttgccgcca
ccggatgtccggatcagcttgtcgccgttggattttgtcaccgaaggccggtcactgatc
ggcagctatctgggttcggcggtgcccagccacgacattccccgcttcgtgtcgttgtgg
caatcgggccgtctgccggtggagtcgctggtgacgtcaacgattcggttggacgatatc
aacgaggcgatggaccacctcgccgatggcatcgcggtgcgtcagctcatcagtttcacc
ggtgatctctaa

DBGET integrated database retrieval system