KEGG   Mycobacterium bovis BCG Tokyo 172: JTY_0704Help
Entry
JTY_0704          CDS       T00864                                 

Gene name
tuf
Definition
elongation factor Tu (EC:3.6.5.3)
Orthology
K02358  
elongation factor Tu
Organism
mbt  Mycobacterium bovis BCG Tokyo 172
Brite
Mitochondrial biogenesis [BR:mbt03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    JTY_0704 (tuf)
Exosome [BR:mbt04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   JTY_0704 (tuf)
  Exosomal proteins of breast cancer cells
   JTY_0704 (tuf)
  Exosomal proteins of colorectal cancer cells
   JTY_0704 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
786591..787781
Genome map
AA seq 396 aa AA seqDB search
MAKAKFQRTKPHVNIGTIGHVDHGKTTLTAAITKVLHDKFPDLNETKAFDQIDNAPEERQ
RGITINIAHVEYQTDKRHYAHVDAPGHADYIKNMITGAAQMDGAILVVAATDGPMPQTRE
HVLLARQVGVPYILVALNKADAVDDEELLELVEMEVRELLAAQEFDEDAPVVRVSALKAL
EGDAKWVASVEELMNAVDESIPDPVRETDKPFLMPVEDVFTITGRGTVVTGRVERGVINV
NEEVEIVGIRPSTTKTTVTGVEMFRKLLDQGQAGDNVGLLLRGVKREDVERGQVVTKPGT
TTPHTEFEGQVYILSKDEGGRHTPFFNNYRPQFYFRTTDVTGVVTLPEGTEMVMPGDNTN
ISVKLIQPVAMDEGLRFAIREGGRTVGAGRVTKIIK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtggcgaaggcgaagttccagcggaccaagccccacgtcaacatcgggaccatcggtcac
gttgaccacggcaagaccaccctgaccgcggctatcaccaaggtcctgcacgacaaattc
cccgatctgaacgagacgaaggcattcgaccagatcgacaacgcccccgaggagcgtcag
cgcggtatcaccatcaacatcgcgcacgtggagtaccagaccgacaagcggcactacgca
cacgtcgacgcccctggccacgccgactacatcaagaacatgatcaccggcgccgcgcag
atggacggtgcgatcctggtggtcgccgccaccgacggcccgatgccccagacccgcgag
cacgttctgctggcgcgtcaagtgggtgtgccctacatcctggtagcgctgaacaaggcc
gacgcagtggacgacgaggagctgctcgaactcgtcgagatggaggtccgcgagctgctg
gctgcccaggaattcgacgaggacgccccggttgtgcgggtctcggcgctcaaggcgctc
gagggtgacgcgaagtgggttgcctctgtcgaggaactgatgaacgcggtcgacgagtcg
attccggacccggtccgcgagaccgacaagccgttcctgatgccggtcgaggacgtcttc
accattaccggccgcggaaccgtggtcaccggacgtgtggagcgcggcgtgatcaacgtg
aacgaggaagttgagatcgtcggcattcgcccatcgaccaccaagaccaccgtcaccggt
gtggagatgttccgcaagctgctcgaccagggccaggcgggcgacaacgttggtttgctg
ctgcggggcgtcaagcgcgaggacgtcgagcgtggccaggttgtcaccaagcccggcacc
accacgccgcacaccgagttcgaaggccaggtctacatcctgtccaaggacgagggcggc
cggcacacgccgttcttcaacaactaccgtccgcagttctacttccgcaccaccgacgtg
accggtgtggtgacactgccggagggcaccgagatggtgatgcccggtgacaacaccaac
atctcggtgaagttgatccagcccgtcgccatggacgaaggtctgcgtttcgcgatccgc
gagggtggccgcaccgtgggcgccggccgggtcaccaagatcatcaagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system