KEGG   Mycobacterium bovis BCG Tokyo 172: JTY_0882Help
Entry
JTY_0882          CDS       T00864                                 

Gene name
fadB
Definition
fatty oxidation protein
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
mbt  Mycobacterium bovis BCG Tokyo 172
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mbt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    JTY_0882 (fadB)
   01212 Fatty acid metabolism
    JTY_0882 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    JTY_0882 (fadB)
   00650 Butanoate metabolism
    JTY_0882 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    JTY_0882 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    JTY_0882 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    JTY_0882 (fadB)
   00310 Lysine degradation
    JTY_0882 (fadB)
   00380 Tryptophan metabolism
    JTY_0882 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    JTY_0882 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    JTY_0882 (fadB)
   00281 Geraniol degradation
    JTY_0882 (fadB)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    JTY_0882 (fadB)
Enzymes [BR:mbt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     JTY_0882 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     JTY_0882 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     JTY_0882 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
958515..960677
Genome map
AA seq 720 aa AA seqDB search
MPDNTIQWDKDADGIVTLTMDDPSGSTNVMNEAYIESMGKAVDRLVAEKDSITGVVVASA
KKTFFAGGDVKTMIQARPEDAGDVFNTVETIKRQLRTLETLGKPVVAAINGAALGGGLEI
ALACHHRIAADVKGSQLGLPEVTLGLLPGGGGVTRTVRMFGIQNAFVSVLAQGTRFKPAK
AKEIGLVDELVATVEELVPAAKAWIKEELKANPDGAGVQPWDKKGYKMPGGTPSSPGLAA
ILPSFPSNLRKQLKGAPMPAPRAILAAAVEGAQVDFDTASRIESRYFASLVTGQVAKNMM
QAFFFDLQAINAGGSRPEGIGKTPIKRIGVLGAGMMGAGIAYVSAKAGYEVVLKDVSLEA
AAKGKGYSEKLEAKALERGRTTQERSDALLARITPTADAADFKGVDFVIEAVFENQELKH
KVFGEIEDIVEPNAILGSNTSTLPITGLATGVKRQEDFIGIHFFSPVDKMPLVEIIKGEK
TSDEALARVFDYTLAIGKTPIVVNDSRGFFTSRVIGTFVNEALAMLGEGVEPASIEQAGS
QAGYPAPPLQLSDELNLELMHKIAVATRKGVEDAGGTYQPHPAEAVVEKMIELGRSGRLK
GAGFYEYADGKRSGLWPGLRETFKSGSSQPPLQDMIDRMLFAEALETQKCLDEGVLTSTA
DANIGSIMGIGFPPWTGGSAQFIVGYSGPAGTGKAAFVARTRELAAAYGDRFLPPESLLS
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgccagacaacacaatccagtgggacaaggatgccgacggcatcgtcacgctgaccatg
gacgatccctccgggtcaaccaacgtgatgaacgaggcctacatcgagtcgatgggcaag
gccgtcgatcgccttgtcgccgaaaaggattcgatcaccggagtggtagtcgccagcgcg
aagaaaaccttcttcgccggcggcgacgtcaagacgatgatccaggccaggcccgaggac
gccggcgatgtattcaacaccgtcgagaccatcaagcggcagctgcgcaccttggagaca
ttgggtaagccggtcgtcgcggccatcaacggggcggcgttgggcggcggcctggagatc
gcgctggcgtgtcatcaccggatcgccgccgacgtcaagggcagccagctcggtctgccg
gaggtgacgctgggtctgctgccgggtggcggtggggtgacccgcacggtacggatgttc
ggcatccagaacgcgttcgtgagcgtgctggcgcaaggtacccggttcaagccggccaag
gccaaggagatcggtctggtcgacgagctggtggcaacggtcgaggagctggtgcccgcc
gccaaggcttggataaaggaggagctcaaggccaaccccgacggtgccggggtgcagccg
tgggacaagaagggctacaagatgcccggcggcaccccgtcgtcgccgggtctggcggcg
attttgccgtcgttcccgtcgaacctgcgcaagcagctcaagggtgccccgatgccggcg
ccgcgggccatcctggccgccgcggtcgagggggcacaggtcgacttcgacaccgccagc
cgcatcgagagccgctacttcgcgtcgttggtcaccggccaggtcgccaagaacatgatg
caggcgttcttcttcgacctgcaggccatcaatgccggcgggtctcggcccgaaggcatc
ggcaagaccccgatcaagaggatcggtgtgctgggtgcgggcatgatgggcgccggcatc
gcctacgtctctgccaaggccggctatgaggtggtactcaaagatgtcagccttgaggcc
gccgctaaaggcaagggctactccgaaaagctggaggccaaggcgctggagcggggccgc
accacacaggagcgcagcgacgccctgctggcgcgcatcaccccgaccgccgacgccgcc
gatttcaagggcgttgatttcgtgatcgaggcggtttttgaaaaccaggagctcaagcac
aaggtgttcggcgagatcgaagacatcgtcgagcccaacgcgatcctgggatccaacacc
tcgacgctgccgatcaccggtctggcgaccggcgtcaagcggcaggaagactttatcggg
atccacttcttctcgccggtcgacaagatgccgctggtggagatcatcaagggcgagaag
acttctgacgaggccctggcccgggtgttcgactacaccttggccatcggcaagaccccg
atcgtggtcaacgacagccgcggctttttcacctcgcgggtcatcggcacgttcgtcaac
gaggcgctggcgatgctcggtgagggtgtcgagccggcttctatcgagcaggcggggtcg
caggccgggtatccggcgccgccgctgcagctgtccgacgagctcaacttagagctgatg
cacaagatcgccgtcgccacccgtaagggtgttgaggacgccggcggcacgtaccagccg
catccggcggaggccgtggtggagaagatgatcgagctcggccggtccggccggctgaag
ggcgcgggcttctacgagtacgccgacggcaagcgatccgggttgtggcccggcttgcgc
gagacgttcaagtcgggctcgtcgcagccgccgctgcaggacatgatcgaccgcatgctg
ttcgccgaggcgctggaaacccagaagtgcctcgacgagggggtgctgacgtcgacggcc
gacgccaacatcggctcgatcatgggcatcggcttcccgccgtggacaggtggcagtgcc
cagttcatcgtcggctactccggcccggccggtaccggtaaggcggctttcgtggcccgg
acccgcgagctggcggccgcctacggcgaccgcttcctgccgccggagtcgctgctaagc
tga

DBGET integrated database retrieval system