KEGG   Mycobacterium bovis BCG Tokyo 172: JTY_1020Help
Entry
JTY_1020          CDS       T00864                                 

Gene name
galU
Definition
(GenBank) putative UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mbt  Mycobacterium bovis BCG Tokyo 172
Pathway
mbt00040  Pentose and glucuronate interconversions
mbt00052  Galactose metabolism
mbt00500  Starch and sucrose metabolism
mbt00520  Amino sugar and nucleotide sugar metabolism
mbt01100  Metabolic pathways
mbt01130  Biosynthesis of antibiotics
Module
mbt_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mbt00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    JTY_1020 (galU)
   00052 Galactose metabolism
    JTY_1020 (galU)
   00500 Starch and sucrose metabolism
    JTY_1020 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    JTY_1020 (galU)
Enzymes [BR:mbt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     JTY_1020 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Imm75
Motif
Other DBs
NCBI-ProteinID: BAH25311
Position
1111422..1112342
Genome map
AA seq 306 aa AA seqDB search
MSRPEVLTPFTAIVPAAGLGTRFLPATKTVPKELLPVVDTPGIELVAAEAAAAGAERLVI
VTSEGKDGVVAHFVEDLVLEGTLEARGKIAMLAKVRRAPALIKVESVVQAEPLGLGHAIG
CVEPTLSPDEDAVAVLLPDDLVLPTGVLETMSKVRASRGGTVLCAIEVAREEISAYGVFD
VEPVPDGDYTDDPNVLKVRGMVEKPKAETAPSRYAAAGRYVLDRAIFDALRRIDRGAGGE
VQLTDAIALLIAEGHPVHVVVHQGSRHDLGNPGGYLKAAVDFALDRDDYGPDLRRWLVAR
LGLTEQ
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgcccagaagtactaacgccgttcacggcaatcgtcccggcagccggcctgggt
acgcgctttctgccggccaccaagacggtgcccaaggagctgctgcccgtcgtcgacact
cccggtatcgagctggtggccgccgaggcggccgcggccggtgccgaacggctggtgatc
gtcacctccgagggtaaggacggggtggtcgcgcatttcgtggaagacctggtgctggag
ggcacgctcgaggcccgaggcaagatcgccatgctggccaaggtgcgtcgcgccccggca
ctgatcaaggtcgaatccgtggtgcaggccgagccgctgggactgggacacgccatcggc
tgtgtggagccgacgctgtcgcccgacgaagacgctgtcgcggtgctgctgcctgacgac
ctggtgctgccgaccggcgtcctggagacgatgtcgaaggtgcgagccagcaggggcggc
accgtgctgtgtgctatcgaggtggcgcgcgaggagatcagtgcctacggggttttcgat
gtcgagccggtccccgatggtgactacaccgacgatcccaacgtgctgaaggtcaggggc
atggtcgaaaagcccaaggccgaaacggcgccgtcgaggtatgcggcggccggccgctac
gttctagaccgtgccatcttcgatgcgttacgccgcatcgaccggggtgcaggcggtgaa
gtgcagctcaccgatgcgatcgcgctgctgattgccgagggccatcccgtccatgtcgtc
gtccaccaagggtcccgacacgacctgggaaatccgggcgggtacctcaaggctgcggtt
gactttgcattggatcgtgacgactacggcccggacttgcggcgatggttggtggcgcga
ctgggtctgacagagcagtag

DBGET integrated database retrieval system