KEGG   Mycobacterium bovis BCG Tokyo 172: JTY_1330Help
Entry
JTY_1330          CDS       T00864                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mbt  Mycobacterium bovis BCG Tokyo 172
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mbt01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:mbt00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:mbt00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1450109..1451191
Genome map
AA seq 360 aa AA seqDB search
MTVPPTATHQPWPGVIAAYRDRLPVGDDWTPVTLLEGGTPLIAATNLSKQTGCTIHLKVE
GLNPTGSFKDRGMTMAVTDALAHGQRAVLCASTGNTSASAAAYAARAGITCAVLIPQGKI
AMGKLAQAVMHGAKIIQIDGNFDDCLELARKMAADFPTISLVNSVNPVRIEGQKTAAFEI
VDVLGTAPDVHALPVGNAGNITAYWKGYTEYHQLGLIDKLPRMLGTQAAGAAPLVLGEPV
SHPETIATAIRIGSPASWTSAVEAQQQSKGRFLAASDEEILAAYHLVARVEGVFVEPASA
ASIAGLLKAIDDGWVARGSTVVCTVTGNGLKDPDTALKDMPSVSPVPVDPVAVVEKLGLA
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcccgccgacggccactcaccagccgtggccgggagtgattgccgcgtaccgt
gaccggctgccggtgggtgacgactggactccggtgaccctgctcgagggtggtactccc
ctcatcgcggcaactaatctctccaagcagacgggctgcacgatccacctcaaagtggag
ggcctcaaccccaccggctccttcaaggatcgtggcatgacgatggcggtcaccgatgcc
cttgcccatggtcagcgggcggtcttgtgcgcatcgaccggaaatacctcggcgtcggcg
gcggcctatgccgcccgggccggcatcacctgcgcggtgctgataccgcagggcaagatc
gcgatgggcaagctcgcacaggcggtcatgcacggcgccaagatcatccagatcgacggt
aacttcgacgactgcctggaactggcgcgcaagatggccgcggacttcccgacgatttcg
ttggtcaactcggtaaacccggtgcgcatcgagggccagaaaacggcagcgttcgagatc
gtcgacgtgctaggtaccgcgccggacgtgcatgctctgccggttggcaacgccggcaac
atcaccgcgtactggaagggctacaccgagtatcaccagctgggcctgatcgacaagttg
ccccgcatgctgggcactcaggccgcgggcgcggcgcccctggtgctcggcgaaccggtg
agccacccggagaccatcgcaaccgcgatccgcatcggctcgccggcgtcgtggacttcg
gccgtcgaggcacagcagcagtccaagggccgcttcttggccgcctccgacgaggagata
ctggccgcatatcacctggtggctcgtgtcgaaggcgtattcgtggagcccgcgtccgca
gccagcattgcgggtctcctcaaagcgatcgacgacggctgggtggcgcgtggttcgacg
gtggtgtgcacggtaaccggcaacggtcttaaggatcccgacaccgcgctcaaagacatg
ccgagcgtgtctccggttcccgtggacccggtagccgtcgtcgagaagctagggctggcc
tag

DBGET integrated database retrieval system