KEGG   Mycobacterium bovis BCG Tokyo 172: JTY_1474Help
Entry
JTY_1474          CDS       T00864                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mbt  Mycobacterium bovis BCG Tokyo 172
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mbt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    JTY_1474 (tpiA)
   01230 Biosynthesis of amino acids
    JTY_1474 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    JTY_1474 (tpiA)
   00051 Fructose and mannose metabolism
    JTY_1474 (tpiA)
   00562 Inositol phosphate metabolism
    JTY_1474 (tpiA)
Enzymes [BR:mbt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     JTY_1474 (tpiA)
Exosome [BR:mbt04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   JTY_1474 (tpiA)
  Exosomal proteins of bladder cancer cells
   JTY_1474 (tpiA)
  Exosomal proteins of melanoma cells
   JTY_1474 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
1613258..1614043
Genome map
AA seq 261 aa AA seqDB search
MSRKPLIAGNWKMNLNHYEAIALVQKIAFSLPDKYYDRVDVAVIPPFTDLRSVQTLVDGD
KLRLTYGAQDLSPHDSGAYTGDVSGAFLAKLGCSYVVVGHSERRTYHNEDDALVAAKAAT
ALKHGLTPIVCIGEHLDVREAGNHVAHNIEQLRGSLAGLLAEQIGSVVTAYEPVWAIGTG
RVASAADAQEVCAAIRKELASLASPRIADTVRVLYGGSVNAKNVGDIVAQDDVDGGLVGG
ASLDGEHFATLAAIAAGGPLP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
gtgagccgcaagccgctgatagccggcaactggaagatgaacctcaaccactacgaggcg
atcgcgctggtgcaaaagatcgcgttctcgttgccggacaagtattacgaccgggttgac
gtcgcggtgatcccgccgtttaccgacctgcgcagcgtgcaaaccctggtcgacggcgac
aagctgcggttgacctatggtgcacaagacttgtcaccacatgactccggtgcctatacg
ggtgacgtcagcggcgcctttctggccaagttggggtgcagttacgttgtcgtcgggcac
tccgagcggcgcacctatcacaacgaggatgacgcgctggtggccgccaaagccgccacc
gcactcaagcatggcttgaccccaatcgtgtgtattggcgagcacctcgacgtccgcgag
gcgggaaatcatgtggcccacaacatcgaacagttgcgtggatcgctggccgggctattg
gccgagcagatcggcagcgtcgtcaccgcctacgaaccggtctgggcgatcggcaccggg
cgggtggccagcgccgccgacgcccaggaggtgtgtgcggcgatccgaaaagagttggcc
tcgttggcctcgccgaggattgccgatacggtgcgggtgctctacggcggctcggtgaac
gccaaaaacgtcggcgacatcgtggcccaggatgacgtcgatggtggcctggtcggcggg
gcgtcgctggacggggagcatttcgcgacgctggccgcgattgcggccggtggtccgttg
ccgtag

DBGET integrated database retrieval system