KEGG   Mycobacterium bovis BCG Tokyo 172: JTY_1830Help
Entry
JTY_1830          CDS       T00864                                 

Definition
dehydrogenase
Orthology
K03885  
NADH dehydrogenase [EC:1.6.99.3]
Organism
mbt  Mycobacterium bovis BCG Tokyo 172
Pathway
Oxidative phosphorylation
Class
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:mbt00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2037150..2038352)
Genome map
AA seq 400 aa AA seqDB search
MTRVVVIGSGFAGLWAALGAARRLDELAVPAGTVDVMVVSNKPFHDIRVRNYEADLSACR
IPLGDVLGPAGVAHVTAEVTAIDADGRRVTTSTGASYSYDRLVLASGSHVVKPALPGLAE
FGFDVDTYDGAVRLQQHLQGLAGGPLTSAAATVVVVGAGLTGIETACELPGRLHALFARG
DGVTPRVVLIDHNPFVGSDMGLSARPVIEQALLDNGVETRTGVSVAAVSPGGVTLSSGER
LAAATVVWCAGMRASRLTEQLPVARDRLGRLQVDDYLRVIGVPAMFAAGDVAAARMDDEH
LSVMSCQHGRPMGRYAGCNVINDLFDQPLLALRIPWYVTVLDLGSAGAVYTEGWERKVVS
QGAPAKTTKQSINTRRIYPPLNGSRADLLAAAAPRVQPRP
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
ttgacccgggtggtggtgatcggctccgggttcgcgggcctgtgggcggcgctcggtgcg
gcccgacgactcgacgagctcgccgtcccagcgggcacggtcgacgtcatggtggtgagc
aacaaaccgtttcatgatatccgggttcgcaactatgaggctgatctgagcgcctgccgc
atcccgctcggcgacgtgctcggccctgccggcgttgcgcatgtcaccgccgaggtgacc
gcgatcgacgccgacggccgccgcgtcaccacgtcgaccggtgcctcatatagctatgac
cgactggtcctcgcgtcgggcagtcacgtggtcaaacccgcgttgccaggactggcagag
ttcggttttgatgtcgacacgtacgacggcgcggtcaggctacagcagcatctgcaagga
ctggccggcgggccgctgacatcggcggcggcaaccgtcgtggtcgtcggtgccgggctg
accggtatcgagacggcctgcgagttgccgggccgactgcacgcgttgttcgcccgtggt
gatggtgtcaccccccgcgtggtactcatcgaccacaaccccttcgtcggctccgatatg
ggtttatcggcgcggccggtgatcgaacaggcgctgttggacaacggcgtcgagaccaga
accggcgtgagcgttgccgccgtcagcccgggcggtgtaacgctgtcatcgggggaacgg
ctggcagcggccaccgtggtgtggtgcgccggcatgcgggccagccgcctgaccgagcag
ctgccggtagcccgtgatcggctgggacgcctgcaagtcgacgactacctgcgggtgatc
ggggtgcctgcgatgtttgctgctggcgatgtggccgcggcccggatggatgacgagcac
ctgtcggtcatgtcgtgtcagcatgggcgcccgatgggccgctatgccggctgcaacgtc
atcaacgatctgttcgaccaaccgttgctggctcttcggatcccttggtatgtcacggtt
ctcgatctaggatcggcgggcgcggtgtacaccgagggatgggaacgcaaagtggtatcg
cagggcgcaccggccaagaccaccaagcagtcaatcaatacccggcggatctacccgccg
ctgaacggcagtcgggcagacttgctggctgcggccgcgccgcgagtacagccccgcccc
tag

DBGET integrated database retrieval system