KEGG   Mycobacterium bovis BCG Tokyo 172: JTY_1928Help
Entry
JTY_1928          CDS       T00864                                 

Gene name
aao
Definition
(GenBank) putative D-amino acid oxidase
  KO
K00273  D-amino-acid oxidase [EC:1.4.3.3]
Organism
mbt  Mycobacterium bovis BCG Tokyo 172
Pathway
mbt00260  Glycine, serine and threonine metabolism
mbt00311  Penicillin and cephalosporin biosynthesis
mbt00330  Arginine and proline metabolism
mbt00472  D-Arginine and D-ornithine metabolism
mbt01100  Metabolic pathways
mbt01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mbt00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    JTY_1928 (aao)
   00330 Arginine and proline metabolism
    JTY_1928 (aao)
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    JTY_1928 (aao)
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    JTY_1928 (aao)
Enzymes [BR:mbt01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     JTY_1928 (aao)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO FAD_binding_2 GIDA FAD_binding_3 Thi4 NAD_binding_8 HI0933_like Pyr_redox_2 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: BAH26214
Position
complement(2134454..2135416)
Genome map
AA seq 320 aa AA seqDB search
MAIGEQQVIVIGAGVSGLTSAICLAEAGWPVRVWAAALPQQTTSAVAGAVWGPRPKEPVA
KVRGWIEQSLHVFRDLAKDPATGVRMTPALSVGDRIETGAMPPGLELIPDVRPADPADVP
GGFRAGFHATLPMIDMPQYLDCLTQRLAATGCEIETRPLRSLAEAAEAAPIVINCAGLGA
RELAGDATVWPRFGQHVVLTNPGLEQLFIERTGGSEWICYFAHPQRVVCGGISIPGRWDT
TPEPEITERILQRCRRIQPRLAEAAVIETITGLRPDRPSVRVEAEPIGRALCIHNYGHGG
DGVTLSWGCAREVVNLVGGG
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
gtggcaataggtgagcaacaggtcatcgtgattggggccggcgtcagcggactgacgtcg
gccatatgcctggccgaggcggggtggccggtgcgggtatgggcggccgcattgccgcag
caaacgacatcggcggtggcgggtgcggtctgggggccgcggccgaaggaacccgttgcc
aaggtacgcgggtggatcgaacagtcattgcacgtgtttcgcgacttggccaaggatccc
gccaccggcgtgcgcatgacgccggcgctgagtgtcggcgatcgtatcgagaccggtgcg
atgccgcccgggttggagctgatccccgacgtgcggccggctgacccggccgacgtgccc
gggggcttccgtgctgggtttcatgccaccttgccgatgatcgatatgccccagtacctc
gactgtctgacccagcgattggcggcgactggctgtgaaatcgaaacgcgcccgctacgg
tcgctggccgaggccgctgaggcggcgcccatagtgatcaactgtgctggtctgggcgct
cgggaactggccggcgacgccacggtctggccgcggttcggccagcacgtcgtcctcacc
aatccaggtctagagcaactgtttatcgagcgcaccggcggctcggaatggatctgctac
tttgcccacccgcagcgtgtagtctgcggcggcatcagtatccctggcaggtgggacacc
accccagagccggagataaccgagcggatcctgcaacggtgtcgccgcatacaaccacgg
cttgccgaggcggcagtgattgagacgattaccgggctgcgtcctgatcggccgtccgtg
cgggtggaagctgaaccgatcgggcgagcgctgtgcatccacaactatggccacggaggt
gacggcgtgaccctgtcatggggttgtgcgcgggaggtggtcaatcttgtcggcggcggt
taa

DBGET integrated database retrieval system