KEGG   Mycobacterium bovis BCG Tokyo 172: JTY_1958Help
Entry
JTY_1958          CDS       T00864                                 

Gene name
echA13
Definition
enoyl-CoA hydratase (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mbt  Mycobacterium bovis BCG Tokyo 172
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mbt00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    JTY_1958 (echA13)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    JTY_1958 (echA13)
   00650 Butanoate metabolism
    JTY_1958 (echA13)
  Lipid metabolism
   00071 Fatty acid degradation
    JTY_1958 (echA13)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    JTY_1958 (echA13)
   00310 Lysine degradation
    JTY_1958 (echA13)
   00360 Phenylalanine metabolism
    JTY_1958 (echA13)
   00380 Tryptophan metabolism
    JTY_1958 (echA13)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    JTY_1958 (echA13)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    JTY_1958 (echA13)
   00281 Geraniol degradation
    JTY_1958 (echA13)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    JTY_1958 (echA13)
   00627 Aminobenzoate degradation
    JTY_1958 (echA13)
   00930 Caprolactam degradation
    JTY_1958 (echA13)
Enzymes [BR:mbt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     JTY_1958 (echA13)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2170354..2171310)
Genome map
AA seq 318 aa AA seqDB search
MFVGRVGPVDRRSDGERSRRPREFEYIRYETIDDGRIAAITLDRPKQRNAQTRGMLVELG
AAFELAEADDTVRVVILRAAGPAFSAGHDLGSADDIRERSPGPDQHPSYRCNGATFGGVE
SRNRQEWHYYFENTKRWRNLRKITIAQVHGAVLSAGLMLAWCCDLIVASEDTVFADVVGT
RLGMCGVEYFGHPWEFGPRKTKELLLTGDCIGADEAHALGMVSKVFPADELATSTIEFAR
RIAKVPTMAALLIKESVNQTVDAMGFSAALDGCFKIHQLNHAHWGEVTGGKLSYGTVEYG
LEDWRAAPQIRPAIKQRP
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgttcgtcggcagggtcggtccggtcgatcgccggtcggacggggaacgctcccgacgg
ccccgggagttcgaatacatccgctacgaaaccatcgacgatgggcgcatcgccgcgatc
accctggaccgcccgaaacaacgcaacgcccagacccgcggcatgctggtcgagctgggc
gccgccttcgaacttgccgaggcggacgacaccgtccgggtggtgatcctgcgggccgcc
ggccccgccttctccgccggtcacgacctcggatccgctgacgatatccgggaacgctcg
cccgggccggaccagcaccccagctaccggtgcaacggggcgaccttcggcggggtcgag
tcacgcaaccgccaggagtggcactactacttcgaaaacaccaagcggtggcgcaacctg
cgcaagatcaccatcgcccaggtgcacggggccgtgctgtcggcggggttgatgctggcc
tggtgctgcgatctgatcgtcgccagcgaggacaccgtgttcgccgatgtggtcggcacc
cggctgggcatgtgcggggtcgagtacttcggacatccgtgggagttcgggccgcgcaag
accaaggaactgctgctcaccggcgactgcataggcgccgacgaggcccacgcgctgggg
atggtcagcaaggtgtttcccgctgacgaactcgcgaccagcacaatcgaattcgcgcgt
cggatcgcgaaggtgccgacgatggcggcactgctgatcaaggaatcggtgaaccaaacc
gtcgatgccatggggttttccgccgcgctggacggttgcttcaagatccaccagctcaat
cacgcgcactggggcgaagtcaccggcggcaagctgtcctacggaacggtcgagtacggc
ctggaggactggcgcgccgcaccgcagatccggcccgcgatcaagcagcggccctga

DBGET integrated database retrieval system