KEGG   Mycobacterium bovis BCG Tokyo 172: JTY_1958Help
Entry
JTY_1958          CDS       T00864                                 

Gene name
echA13
Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mbt  Mycobacterium bovis BCG Tokyo 172
Pathway
mbt00071  Fatty acid degradation
mbt00280  Valine, leucine and isoleucine degradation
mbt00281  Geraniol degradation
mbt00310  Lysine degradation
mbt00360  Phenylalanine metabolism
mbt00362  Benzoate degradation
mbt00380  Tryptophan metabolism
mbt00410  beta-Alanine metabolism
mbt00627  Aminobenzoate degradation
mbt00640  Propanoate metabolism
mbt00650  Butanoate metabolism
mbt00903  Limonene and pinene degradation
mbt00930  Caprolactam degradation
mbt01100  Metabolic pathways
mbt01110  Biosynthesis of secondary metabolites
mbt01120  Microbial metabolism in diverse environments
mbt01130  Biosynthesis of antibiotics
mbt01212  Fatty acid metabolism
Module
mbt_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mbt00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    JTY_1958 (echA13)
   00650 Butanoate metabolism
    JTY_1958 (echA13)
  Lipid metabolism
   00071 Fatty acid degradation
    JTY_1958 (echA13)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    JTY_1958 (echA13)
   00310 Lysine degradation
    JTY_1958 (echA13)
   00360 Phenylalanine metabolism
    JTY_1958 (echA13)
   00380 Tryptophan metabolism
    JTY_1958 (echA13)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    JTY_1958 (echA13)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    JTY_1958 (echA13)
   00281 Geraniol degradation
    JTY_1958 (echA13)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    JTY_1958 (echA13)
   00627 Aminobenzoate degradation
    JTY_1958 (echA13)
   00930 Caprolactam degradation
    JTY_1958 (echA13)
Enzymes [BR:mbt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     JTY_1958 (echA13)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: BAH26243
Position
complement(2170354..2171310)
Genome map
AA seq 318 aa AA seqDB search
MFVGRVGPVDRRSDGERSRRPREFEYIRYETIDDGRIAAITLDRPKQRNAQTRGMLVELG
AAFELAEADDTVRVVILRAAGPAFSAGHDLGSADDIRERSPGPDQHPSYRCNGATFGGVE
SRNRQEWHYYFENTKRWRNLRKITIAQVHGAVLSAGLMLAWCCDLIVASEDTVFADVVGT
RLGMCGVEYFGHPWEFGPRKTKELLLTGDCIGADEAHALGMVSKVFPADELATSTIEFAR
RIAKVPTMAALLIKESVNQTVDAMGFSAALDGCFKIHQLNHAHWGEVTGGKLSYGTVEYG
LEDWRAAPQIRPAIKQRP
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgttcgtcggcagggtcggtccggtcgatcgccggtcggacggggaacgctcccgacgg
ccccgggagttcgaatacatccgctacgaaaccatcgacgatgggcgcatcgccgcgatc
accctggaccgcccgaaacaacgcaacgcccagacccgcggcatgctggtcgagctgggc
gccgccttcgaacttgccgaggcggacgacaccgtccgggtggtgatcctgcgggccgcc
ggccccgccttctccgccggtcacgacctcggatccgctgacgatatccgggaacgctcg
cccgggccggaccagcaccccagctaccggtgcaacggggcgaccttcggcggggtcgag
tcacgcaaccgccaggagtggcactactacttcgaaaacaccaagcggtggcgcaacctg
cgcaagatcaccatcgcccaggtgcacggggccgtgctgtcggcggggttgatgctggcc
tggtgctgcgatctgatcgtcgccagcgaggacaccgtgttcgccgatgtggtcggcacc
cggctgggcatgtgcggggtcgagtacttcggacatccgtgggagttcgggccgcgcaag
accaaggaactgctgctcaccggcgactgcataggcgccgacgaggcccacgcgctgggg
atggtcagcaaggtgtttcccgctgacgaactcgcgaccagcacaatcgaattcgcgcgt
cggatcgcgaaggtgccgacgatggcggcactgctgatcaaggaatcggtgaaccaaacc
gtcgatgccatggggttttccgccgcgctggacggttgcttcaagatccaccagctcaat
cacgcgcactggggcgaagtcaccggcggcaagctgtcctacggaacggtcgagtacggc
ctggaggactggcgcgccgcaccgcagatccggcccgcgatcaagcagcggccctga

DBGET integrated database retrieval system