KEGG   Mycobacterium bovis BCG Tokyo 172: JTY_2225Help
Entry
JTY_2225          CDS       T00864                                 

Gene name
dlaT
Definition
dihydrolipoamide acetyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mbt  Mycobacterium bovis BCG Tokyo 172
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mbt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    JTY_2225 (dlaT)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    JTY_2225 (dlaT)
  Amino acid metabolism
   00310 Lysine degradation
    JTY_2225 (dlaT)
Enzymes [BR:mbt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     JTY_2225 (dlaT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2453381..2455042
Genome map
AA seq 553 aa AA seqDB search
MAFSVQMPALGESVTEGTVTRWLKQEGDTVELDEPLVEVSTDKVDTEIPSPAAGVLTKII
AQEDDTVEVGGELAVIGDAKDAGEAAAPAPEKVPAAQPESKPAPEPPPVQPTSGAPAGGD
AKPVLMPELGESVTEGTVIRWLKKIGDSVQVDEPLVEVSTDKVDTEIPSPVAGVLVSISA
DEDATVPVGGELARIGVAADIGAAPAPKPAPKPVPEPAPTPKAEPAPSPPAAQPAGAAEG
APYVTPLVRKLASENNIDLAGVTGTGVGGRIRKQDVLAAAEQKKRAKAPAPAAQAAAAPA
PKAPPAPAPALAHLRGTTQKASRIRQITANKTRESLQATAQLTQTHEVDMTKIVGLRARA
KAAFAEREGVNLTFLPFFAKAVIDALKIHPNINASYNEDTKEITYYDAEHLGFAVDTEQG
LLSPVIHDAGDLSLAGLARAIADIAARARSGNLKPDELSGGTFTITNIGSQGALFDTPIL
VPPQAAMLGTGAIVKRPRVVVDASGNESIGVRSVCYVPLTYDHRLIDGADAGRFLTTIKH
RLEEGAFEADLGL
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggccttctccgtccagatgccggcactcggtgagagcgtcaccgaggggacggttacc
cgctggctcaaacaggaaggcgacacggtcgaactcgacgagcccctcgtggaggtgtcg
accgacaaggtcgacaccgaaatcccctcgccggccgcgggtgtgctgaccaagatcatc
gcccaggaggatgacacggtcgaggtcggcggcgagctcgctgtcattggcgacgccaag
gatgccggcgaggccgcggccccggcacccgagaaagtccctgcggcccaacccgagtcc
aagccggcacccgaaccaccaccggtccaaccgacgtccggagcgcctgctggtggcgat
gccaagccggtgctgatgcccgagctcggcgaatcggtgaccgaggggaccgtcattcgt
tggctgaagaagatcggggattcggttcaggttgacgagccactcgtggaggtgtccacc
gacaaggtggacaccgagatcccgtccccggtggctggggtcttggtcagtatcagcgcc
gacgaggacgccacggtgcccgtcggcggcgagttggcccggatcggtgtcgctgccgac
atcggcgccgcgcccgcccccaagcccgcacccaagcccgtccccgagccagcgccgacg
ccgaaggccgaacccgcaccatcgccgccggcggcccagccagccggtgcggccgagggc
gcaccgtacgtgacgccgctggtgcgaaagctggcgtcggaaaacaacatcgacctcgcc
ggggtgaccggcaccggagtgggtggtcgcatccgcaaacaggatgtgctggccgcggct
gagcaaaagaagcgggcgaaagcaccggcgccggccgcccaggccgccgccgcgccggcc
ccgaaagcgccgcctgcccctgcgccggcgttggcacatctacggggcaccacccagaag
gccagccggattcgtcagatcaccgccaacaagacccgcgaatctttgcaggcaacggca
cagctgacacaaacccatgaggtcgacatgaccaagatcgtggggctacgggcccgggcc
aaggcggcgttcgccgagcgtgagggcgtgaacctgaccttcctgccgttcttcgccaag
gccgtgatcgatgccctcaagattcacccgaacatcaacgctagctacaacgaggacacc
aaggagatcacctactacgacgccgagcacctaggattcgctgtcgacaccgagcagggc
ctgctctccccggtcatccacgacgccggcgatctgtcactggccggtctggcgcgggcg
atcgccgatatcgcggcccgtgcccggtcgggcaacctgaaacccgacgagttgtccggc
ggcaccttcaccatcaccaacatcggtagccagggcgcgttgttcgacaccccgatcctg
gttccgccgcaggccgccatgctgggcaccggggcgatcgtcaagcggccgcgggtggtc
gtcgatgccagcggcaacgagtcgatcggggtgcgctcggtctgctacgtcccgttgacc
tatgaccatcggctcatcgacggcgccgacgccggacgtttcctcaccacgatcaagcac
cgcctcgaagagggagcgttcgaggccgatttaggactgtga

DBGET integrated database retrieval system