KEGG   Mycobacterium bovis BCG Tokyo 172: JTY_2453Help
Entry
JTY_2453          CDS       T00864                                 

Gene name
proB
Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
mbt  Mycobacterium bovis BCG Tokyo 172
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:mbt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    JTY_2453 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    JTY_2453 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    JTY_2453 (proB)
Enzymes [BR:mbt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     JTY_2453 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2695059..2696189)
Genome map
AA seq 376 aa AA seqDB search
MRSPHRDAIRTARGLVVKVGTTALTTPSGMFDAGRLAGLAEAVERRMKAGSDVVIVSSGA
IAAGIEPLGLSRRPKDLATKQAAASVGQVALVNSWSAAFARYGRTVGQVLLTAHDISMRV
QHTNAQRTLDRLRALHAVAIVNENDTVATNEIRFGDNDRLSALVAHLVGADALVLLSDID
GLYDCDPRKTADATFIPEVSGPADLDGVVAGRSSHLGTGGMASKVSAALLAADAGVPVLL
APAADAATALADASVGTVFAARPARLSARRFWVRYAAEATGALTLDAGAVRAVVRQRRSL
LAAGITAVSGRFCGGDVVELRAPDAAMVARGVVAYDASELATMVGRSTSELPGELRRPVV
HADDLVAVSAKQAKQV
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgagaagtccgcatcgggacgcaatccggaccgcgcgcggccttgtcgtgaaggtcggg
accacggcgcttaccacaccgtccgggatgttcgatgccggccggctggccggactggcc
gaggcggtcgagcggcggatgaaggcgggttccgacgtcgtcatcgtgtcttcgggcgcc
atcgccgccggcatcgagccgctcgggctgtcccgtcgtcccaaagatctggcgaccaag
caggcggcggccagcgtcgggcaggtcgcgctggtgaactcgtggagcgcggcgttcgcc
cgctacggccgcacggtgggccaggtgctgctgaccgcgcacgacatttcgatgcgggtg
cagcacaccaacgcccaacgcacgctggatcggctgcgcgcgttgcacgcggtggcgatt
gtcaacgagaacgacaccgtggccaccaacgagatccggttcggtgacaacgatcggctg
tctgcactggtggcgcacctggtcggcgccgacgctttggtgctgctgtcggacatcgac
ggcctctacgactgcgacccgcgcaaaaccgcggacgcgacgttcattccggaggtgtcc
gggccggcggatctggacggtgtggtcgccggccgcagtagccacctgggtactggcggc
atggcgtccaaggtgtcggcggcgctgttggccgccgacgccggggtgccggtactgctg
gcccccgcggccgacgccgcgaccgcgctcgccgacgcgtcggtgggcacggtgtttgcg
gcccggcccgcgcgtctgtcggcccggcggttctgggtgcgttatgccgccgaagcaacc
ggcgcactgactctcgacgccggtgcggtgcgcgctgtggtgcgacaacgccggtcactg
ctggcggcgggtatcaccgcggtgtccggccggttttgcggcggcgatgtggtcgaactg
cgtgcacccgacgcggccatggtagcccgcggggtggttgcctacgacgcgtccgagctg
gccaccatggtgggccggtccacctctgagctacccggcgagctgcgccgcccggtggtg
cacgccgacgatctggtcgcggtgtcggcgaagcaagctaagcaagtttag

DBGET integrated database retrieval system