KEGG   Mycobacterium bovis BCG Tokyo 172: JTY_2865Help
Entry
JTY_2865          CDS       T00864                                 

Definition
magnesium chelatase
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
mbt  Mycobacterium bovis BCG Tokyo 172
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mbt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    JTY_2865
Enzymes [BR:mbt01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     JTY_2865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3104978..3106867)
Genome map
AA seq 629 aa AA seqDB search
MKPYPFSAIVGHDRLRLALLLCAVRPEIGGALIRGEKGTAKSTAVRGLAALLSVATGSTE
TGLVELPLGATEDRVVGSLDLQRVMRDGEHAFSPGLLARAHGGVLYVDEVNLLHDHLVDI
LLDAAAMGRVHVERDGISHSHEARFVLIGTMNPEEGELRPQLLDRFGLTVDVQASRDIDV
RVQVIRRRMAYEADPDAFVARYADADAELAHRIAAARATVDDVVLGDNELRRIAALCAAF
DVDGMRADLVVARTAAAHAAWRGVRTVEEQDIQAAAELALPHRRRRDPFDDHGIDRDQLD
EALALASVDPEPEPDPPGGGQSANEPASQPNSRSKSTEPGAPSSMGDDPPRPASPRLRSS
PRPSAPPSKIFRTRALRVPGVGTGAPGRRSRARNASGSVVAAAEVSDPDAHGLHLFATLL
AAGERAFGAGPLRPWPDDVRRAIRESREGNLVIFVVDASGSMAARDRMAAVSGATLSLLR
DAYQRRDKVAVITFRQHEATLLLSPTSSAHIAGRRLARFSTGGKTPLAEGLLAARALIIR
EKVRDRARRPLVVVLTDGRATAGPDPLGRSRTAAAGLVAEGAAAVVVDCETSYVRLGLAA
QLARQLGAPVVRLEQLHADYLVHAVRGVA
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
gtgaagccttatccgttcagcgcgatcgtcgggcacgatcggctgcggctcgcgttgttg
ttgtgtgccgtgcgaccggagatcggtggggcgctcatccgtggcgagaagggcacggcg
aaatcgacggcggtgcgcgggctggccgcgttgttgtcggtcgcgaccgggagcaccgag
accggcctcgtggagctgccgctgggggccaccgaagaccgggtggttggctcgctggat
ctgcagcgggtgatgcgcgacggcgagcacgcgttctctccgggactgctggctcgcgcc
cacggcggcgtgctctacgtcgacgaggtcaatctgctgcatgatcacctggttgacatc
ctgctcgacgccgccgccatgggacgcgtacacgtcgaacgcgacggcatctcccattcc
cacgaggcccgtttcgtgctgatcggcacgatgaatccggaggagggcgaactgcgtccg
cagctgctggaccggttcgggctgaccgtcgacgtgcaggcgtcacgtgacatcgacgtg
cgggtacaggtcatccgccggcggatggcctacgaagccgacccggatgcgttcgtcgca
cgctatgccgacgccgacgcggagctggcccaccggattgccgcggcccgggccacggta
gacgatgtggtgttgggcgacaacgagttgcggcgcatcgctgcgttgtgcgcggcgttc
gacgtggacggcatgcgggccgatctggtagtggcccggaccgccgccgcgcacgccgcc
tggcgtggtgtccgcaccgttgaggagcaggatatccaggcggcagcagaactggcgttg
ccgcatcgtcgtcgtcgcgacccgttcgacgatcacggcatcgaccgcgaccagctggat
gaggcgctggcgctggcgagcgtcgacccagagcccgagcccgatccgcccgggggcggc
cagtcagccaatgaacctgcctcacaaccgaactcacgctcgaagtcgacagaacctggt
gcgccgagctcgatgggcgacgacccgccgcgcccggcttcgccgcgcttgcgatcgtcg
ccgcgcccgagcgcgccgccgtcaaagatattccggacccgcgcgctgcgggtcccgggg
gtcggcacgggcgcgccggggcgacggtctcgggcccgcaacgcctcgggcagtgtggtg
gcggccgccgaggtcagcgaccccgacgcacatggactgcacctgttcgctaccctgctg
gccgccggcgagcgtgcgttcggagccgggccgttgcgcccgtggccggacgatgtgcgc
cgggccatccgcgagagtcgcgaaggcaatctggtgatcttcgtcgtcgacgcttccgga
tcgatggctgctcgggaccggatggctgcggtcagtggcgccaccctgtcgctgctgcgc
gacgcctaccagcgcagggacaaggtggcggtgatcaccttccgccagcacgaggcaacg
ctgttgctgtcgccgacgtcgtcggcgcacatcgccggccggcgactggcccgattcagc
accggcggcaagaccccgctggctgagggactgctggccgcgcgtgcgctgatcatccgg
gagaaggtacgcgaccgcgcccgacgccccctggtggtcgtgctgaccgacggccgggcc
accgccgggccggacccgttgggccgcagccgaaccgcggctgccgggctggtcgccgag
ggcgcggccgcggtggtggtggactgcgaaacgtcgtatgtacggctgggtttggcagcg
caactggctcgtcagctgggtgcgccggtggttcggttggagcagttgcacgcggattat
ctagtgcatgccgtgcgtggcgtggcttga

DBGET integrated database retrieval system