KEGG   Mycobacterium bovis BCG Tokyo 172: JTY_3380Help
Entry
JTY_3380          CDS       T00864                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
mbt  Mycobacterium bovis BCG Tokyo 172
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbt00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    JTY_3380 (deoA)
Enzymes [BR:mbt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     JTY_3380 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3688651..3689934)
Genome map
AA seq 427 aa AA seqDB search
MTDFAFDAPTVIRTKRDGGRLSDAAIDWVVKAYTDGRVADEQMSALLMAIVWRGMDRGEI
ARWTAAMLASGARLDFTDLPLATVDKHSTGGVGDKITLPLVPVVAACGGAVPQASGRGLG
HTGGTLDKLESITGFTANLSNQRVREQLCDVGAAIFAAGQLAPADAKLYALRDITGTVES
LPLIASSIMSKKLAEGAGALVLDVKVGSGAFMRSPVQARELAHTMVELGAAHGVPTRALL
TEMNCPLGRTVGNALEVAEALEVLAGGGPPDVVELTLRLAGEMLELAGIHGRDPAQTLRD
GTAMDRFRWLVAAQGGDLSKPLPIGSHSETVTAGASGTMGDIDAMAVGLAAWRLGAGRSR
PGARVQHGAGVRIHRRPGEPVVVGEPLFTLYTNAPERFGAARAELAGGWSIRDSPPQVRP
LIVDRIV
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacttcgcattcgacgccccgaccgtcatccgcaccaaacgtgacggcggccgg
ttgtccgacgccgccatcgactgggtcgtcaaggcctataccgacggccgggtcgccgac
gaacagatgtcggcgctgctgatggcgatcgtttggcggggcatggaccgcggcgagatc
gccagatggacggcggccatgctggcctcgggtgcccggctggatttcaccgatctgcca
ctagcgaccgtggacaagcattccaccggcggggtaggtgacaaaatcacgctgccattg
gtgcccgtcgtcgccgcctgcggtggcgcagtgccccaggcgtcgggccgcggactcggc
cacaccggcggcaccctggacaagctggaatccatcaccgggttcaccgcgaatctgtcc
aaccagcgggtgcgcgagcagctttgcgacgtcggcgccgcgatcttcgccgccggccag
ctggcgccagccgatgccaagctgtatgcgctgcgcgacattaccggcaccgtcgaatcg
ctgccgttgatcgccagttcgattatgagcaagaagctggctgagggtgcgggtgcactg
gtgctcgacgtcaaggttggttccggggccttcatgaggtcgccagtgcaggcgcgcgaa
cttgcgcacaccatggtcgaactgggcgcggcgcatggcgtgcccacccgtgccctgctg
acggagatgaactgcccgctgggtcgaaccgtcggcaatgcgctcgaggtggccgaggcg
ctggaggtgctggccggcggcggaccgcccgacgtggtggagctgacgttgcggctggcc
ggcgagatgctcgagcttgccgggatccacggccgggacccggcccagacgctgcgggac
ggcaccgcaatggaccggtttcgctggttggttgccgcgcagggaggtgacttgtcgaaa
ccgttgccgatcggttcgcattcggaaaccgtcacggcgggcgcgagcggcacaatgggc
gacatcgatgcgatggcagtggggttagcggcatggcgactcggtgcgggcaggtcccgc
ccgggcgcacgcgtacagcacggtgcgggggtgcggattcatcgccgcccgggggagccg
gttgtggtcggtgagccgttgttcaccctctacacgaatgctcccgagcgctttggtgcg
gcgcgagccgagctggccggcggttggagtatccgggacagtccgccgcaggtgcggccg
ctaatcgtcgatcggatcgtctga

DBGET integrated database retrieval system