KEGG   Mycobacterium bovis BCG Tokyo 172: JTY_3530Help
Entry
JTY_3530          CDS       T00864                                 

Gene name
rmlC
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
mbt  Mycobacterium bovis BCG Tokyo 172
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mbt00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    JTY_3530 (rmlC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    JTY_3530 (rmlC)
Enzymes [BR:mbt01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     JTY_3530 (rmlC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3862239..3862847
Genome map
AA seq 202 aa AA seqDB search
MKARELDVPGAWEITPTIHVDSRGLFFEWLTDHGFRAFAGHSLDVRQVNCSVSSAGVLRG
LHFAQLPPSQAKYVTCVSGSVFDVVVDIREGSPTFGRWDSVLLDDQDRRTIYVSEGLAHG
FLALQDNSTVMYLCSAEYNPQREHTICATDPTLAVDWPLVDGAAPSLSDRDAAAPSFEDV
RASGLLPRWEQTQRFIGEMRGT
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcacgcgaactcgacgtccccggcgcctgggagattaccccgaccatccatgtc
gattcccgcggactgttcttcgaatggcttaccgatcatgggttccgcgcattcgcaggt
cacagtttggacgtccggcaagtgaactgctcggtgtcatcggccggtgtgctgcgcggc
ctgcactttgcccagttgccgccgagccaggccaagtatgtgacctgcgtttccggctcg
gtgttcgatgtcgtcgtcgacatccgagagggctcaccgacattcggccgatgggactcg
gtgctgctcgacgaccaagaccgtaggacgatctacgtctccgaaggcctagcgcacggc
ttccttgcactgcaagacaattcgacggtgatgtacttgtgctcggcggaatacaatccg
cagcgcgagcacaccatctgcgccacagatccgacgttggcggtcgattggccgctggtc
gatggcgctgcccccagcctgtccgaccgtgatgccgctgcgcccagcttcgaggatgtg
cgcgcgtctggcctgctgcccaggtgggaacagacgcagcggttcattggggagatgcgc
ggcacctag

DBGET integrated database retrieval system