KEGG   Mycobacterium bovis BCG Tokyo 172: JTY_3673Help
Entry
JTY_3673          CDS       T00864                                 

Gene name
folP1
Definition
dihydropteroate synthase 1 (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
mbt  Mycobacterium bovis BCG Tokyo 172
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    JTY_3673 (folP1)
Enzymes [BR:mbt01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     JTY_3673 (folP1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4025414..4026256)
Genome map
AA seq 280 aa AA seqDB search
MSPAPVQVMGVLNVTDDSFSDGGCYLDLDDAVKHGLAMAAAGAGIVDVGGESSRPGATRV
DPAVETSRVIPVVKELAAQGITVSIDTMRADVARAALQNGAQMVNDVSGGRADPAMGPLL
AEADVPWVLMHWRAVSADTPHVPVRYGNVVAEVRADLLASVADAVAAGVDPARLVLDPGL
GFAKTAQHNWAILHALPELVATGIPVLVGASRKRFLGALLAGPDGVMRPTDGRDTATAVI
SALAALHGAWGVRVHDVRASVDAIKVVEAWMGAERIERDG
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
gtgagtccggcgcccgtgcaggtgatgggggttctaaacgtcacggacgactctttctcg
gacggcgggtgttatctcgatctcgacgatgcggtgaagcacggtctggcgatggcagcc
gcaggtgcgggcatcgtcgacgtcggtggtgagtcgagccggcccggtgccactcgggtt
gacccggcggtggagacgtctcgtgtcatacccgtcgtcaaagagcttgcagcacaaggc
atcaccgtcagcatcgataccatgcgcgcggatgtcgctcgggcggcgttgcagaacggt
gcccagatggtcaacgacgtgtcgggtgggcgggccgatccggcgatggggccgctgttg
gccgaggccgatgtgccgtgggtgttgatgcactggcgggcggtatcggccgataccccg
catgtgcctgtgcgctacggcaacgtggtggccgaggtccgtgccgacctgctggccagc
gtcgccgacgcggtggccgcaggcgtcgacccggcaaggctggtgctcgatcccgggctt
ggattcgccaagacggcgcaacataattgggcgatcttgcatgcccttccggaactggtc
gcgaccggaatcccagtgctggtgggtgcttcgcgcaagcgcttcctcggtgcgttgttg
gccgggcccgacggcgtgatgcggccaaccgatgggcgtgacaccgcgacggcggtgatt
tccgcgctggccgcactgcacggggcctggggtgtgcgggtgcatgatgtgcgggcctcg
gtcgatgccatcaaggtggtcgaagcgtggatgggagcggaaaggatagaacgcgatggc
tga

DBGET integrated database retrieval system