KEGG   Mycobacterium bovis BCG Tokyo 172: JTY_3838Help
Entry
JTY_3838          CDS       T00864                                 

Gene name
echA21
Definition
enoyl-CoA hydratase (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mbt  Mycobacterium bovis BCG Tokyo 172
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mbt00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    JTY_3838 (echA21)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    JTY_3838 (echA21)
   00650 Butanoate metabolism
    JTY_3838 (echA21)
  Lipid metabolism
   00071 Fatty acid degradation
    JTY_3838 (echA21)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    JTY_3838 (echA21)
   00310 Lysine degradation
    JTY_3838 (echA21)
   00360 Phenylalanine metabolism
    JTY_3838 (echA21)
   00380 Tryptophan metabolism
    JTY_3838 (echA21)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    JTY_3838 (echA21)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    JTY_3838 (echA21)
   00281 Geraniol degradation
    JTY_3838 (echA21)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    JTY_3838 (echA21)
   00627 Aminobenzoate degradation
    JTY_3838 (echA21)
   00930 Caprolactam degradation
    JTY_3838 (echA21)
Enzymes [BR:mbt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     JTY_3838 (echA21)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4188445..4189269
Genome map
AA seq 274 aa AA seqDB search
MGETYESVTVETKDQVAQVTLIGPGKGNAMGPAFWSEMPEVFHALDADREVRAIVITGSG
KNFSYGLDVPAMGGMFAPLIADGALARPRTDFHTEILRMQKAINAVADCRTPTIAAVQGW
CIGGAVDLISAVDIRYASADAKFSVREVKLAIVADMGSLARLPLILSDGHLRELALTGKN
IDAARAEKIGLVNDVYDDADQTLAAAHATAAEIAANPPLAVYGIKDVLDQQRTSAVSENL
RYVAAWNAAFLPSKDLTEGISATFAKRPPQFTGE
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgggcgaaacctacgaatccgtcaccgtcgaaaccaaggaccaggtcgcgcaggtgacg
ctgatcgggccgggcaagggcaacgcgatggggcccgcattctggtcggagatgcccgag
gtgttccatgccctggacgccgaccgtgaggtgcgggccatcgtcatcaccggatcgggc
aagaacttcagctacggcctggacgtaccggccatgggcggaatgttcgccccgttgatc
gccgacggcgcgctggcccgcccacgcacggacttccacaccgaaatactgcgcatgcag
aaggcgatcaacgccgtcgccgactgccgcacccccacgatcgcggccgtccagggttgg
tgcatcggcggcgccgtcgacctgatctccgcggtcgacatccggtatgccagcgccgac
gcgaagttctcggtgcgcgaggtcaagctagcgattgttgccgacatgggcagcctggcg
cgccttccactaatcctgagcgacggccatctacgagaactcgcgctgaccggcaaaaat
atcgacgcggcccgcgccgagaagatcggcctggtcaacgacgtctacgatgacgccgac
cagacgctggccgcggcccacgcgactgccgccgagatcgccgccaacccacctttggcg
gtctacggcatcaaggacgttctcgaccaacaacgcacgtccgccgtctcggagaacctg
cgctatgtcgccgcctggaacgccgcgtttctgccgtccaaggacctcaccgaaggtatt
tccgcgacgttcgccaagcgcccgccccagttcaccggcgagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system