KEGG   Methanococcoides burtonii: Mbur_0107Help
Entry
Mbur_0107         CDS       T00341                                 

Gene name
trpC
Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mbu  Methanococcoides burtonii
Pathway
mbu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mbu01100  Metabolic pathways
mbu01110  Biosynthesis of secondary metabolites
mbu01130  Biosynthesis of antibiotics
mbu01230  Biosynthesis of amino acids
Module
mbu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mbu00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mbur_0107 (trpC)
Enzymes [BR:mbu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Mbur_0107 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE His_biosynth PcrB ThiG DHO_dh Radical_SAM FMN_dh PEP_hydrolase
Motif
Other DBs
NCBI-ProteinID: ABE51125
JGI: Mbur0107
UniProt: Q12ZK1
Position
94544..95359
Genome map
AA seq 271 aa AA seqDB search
MHSAIHEIINSTEKRVKALYEAEDHPILKGDTQGIEKIIEAIHSKKDSGKVPIIAEVKPA
SPSMKIMDISPEEAGKIAMDMENAGAIAISVLTEPEFFEGSIDNLKAVREAISLPVLRKD
FIIDKVQFDEVRSDLILLIAGLLGEKLEELIEYARSKEFEPLVEVHNKEELTYVLENSSA
KIVGINNRDLTTLEVDIATTEELIPIIKKYDRRTGEEHLVISESGVHTPEDARRMMRAGA
DAILIGTSIVKDEDIYRKTKELVDALDNTIE
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgcactctgcaatacatgaaattatcaattctacggaaaagcgggttaaagcgctttac
gaagcggaagatcatccaattttgaagggagatacacaggggatagagaagataatcgaa
gctattcattcaaaaaaggatagtggaaaggttccgatcattgccgaggtcaaacctgca
tccccgtctatgaaaataatggacatttcaccggaagaagcgggaaaaattgccatggat
atggaaaatgcaggagctattgccatatcggtccttacagaaccagagttctttgaaggt
tccattgataatcttaaagctgtcagagaagctatttcactacccgtcctgagaaaagat
ttcattattgataaggtgcagttcgatgaggtaagaagtgatcttatattattgatagca
ggacttctcggcgagaaactggaagaactcatcgaatatgcacgatcaaaggaattcgaa
cctcttgtggaagtacacaataaggaagaacttacatatgttcttgagaatagttcagca
aagatagtaggtatcaataatcgcgaccttacaacccttgaggtggatattgctaccaca
gaggaacttataccgataataaaaaagtacgacaggagaacaggtgaagagcaccttgtg
atcagtgagagtggcgtacacacacctgaagacgcaagaaggatgatgagagccggtgct
gatgcgatacttatcggaacttccattgtcaaagatgaagatatttatagaaagaccaaa
gaactggtcgatgcacttgataacactatagaatga

DBGET integrated database retrieval system