KEGG   Methanococcoides burtonii: Mbur_0108Help
Entry
Mbur_0108         CDS       T00341                                 

Gene name
trpB1
Definition
(GenBank) Tryptophan synthase beta chain 1
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mbu  Methanococcoides burtonii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mbu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mbur_0108 (trpB1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mbur_0108 (trpB1)
Enzymes [BR:mbu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mbur_0108 (trpB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
95377..96558
Genome map
AA seq 393 aa AA seqDB search
MSNTKYGKYGGQFVPEILMPALEELEQGYEKYRNDPQFMEELDYYLKDFAGRETPLYHAR
NLSKKYGTKIYLKREDLVHGGAHKLNNTIGQALLAKYMGKSRLVAETGAGQHGTATAMAG
TNLGFETHVYMGAKDMERQRMNVYRMEIMGTEVHPVESGSRTLKDAINEALRDWVSNVEN
THYLIGSVVGPHPYPMMVRDFQSVIGNEVKQQIIKKEGRYPDSIVACAGGGSNAMGIFHP
FIEEDVKLIAVEAGGKGMEYTKDAALHSASLSVGEDGVLQGARTRILQDEYGQILESSSI
SAGLDYSGVGPELAHLADIGRILPRVVNDDLALEAFHELSRVEGIIPALESSHAVAHVME
AAESGELGELVVINLSGRGDKDLETVIGLERRK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatacaaaatatggaaagtacggtggacagttcgtccccgagatactgatgcct
gctctcgaagaacttgagcagggatatgagaagtacaggaacgatccacaatttatggag
gagcttgattattatctgaaagattttgcaggtcgggaaacacctctttatcacgccagg
aacctcagcaaaaaatacggtacaaagatttatctaaaaagggaagatcttgtgcatggt
ggcgctcacaaactaaacaacacgatcggccaggcgttgcttgcaaagtatatgggaaag
tcaagacttgtagcagagaccggggcaggccagcatggtactgctactgccatggcaggg
actaatctgggattcgagacccatgtatatatgggcgccaaggatatggaaagacagcgc
atgaacgtgtatcgaatggagatcatgggtacagaagtacatccggtcgagtccggctca
agaacacttaaagatgctatcaacgaagcactgcgcgattgggtctcaaatgtagagaat
acacattatctgataggttcagtagttggaccacatccatatccaatgatggtaagagat
tttcagagcgtgatcggaaatgaggtaaagcaacagataataaaaaaggagggtcgttat
ccggattcaatagttgcctgtgcaggtggtggcagtaatgccatggggatattccacccg
ttcattgaagaggatgtgaaacttatagcggtagaagcaggcggaaaaggtatggaatat
accaaagatgcggcacttcattcggcatcactttccgttggagaagatggcgttctccag
ggtgctcgtacccgcatacttcaggatgagtatggccagatcctcgaatcaagttctatt
tcagcaggactggattattcaggagtaggtccggaacttgcccatcttgcggatattgga
agaattctgccccgtgttgtcaatgatgacttggcattggaagcgtttcacgaactaagc
cgtgtggaaggcatcatccctgcacttgaatcatctcatgcagtagcacatgttatggaa
gcagcagagtcaggagaacttggcgagcttgtggtcatcaatctatccggaagaggagac
aaggaccttgaaaccgttattgggctcgaaaggaggaagtga

DBGET integrated database retrieval system