KEGG   Methanococcoides burtonii: Mbur_0109Help
Entry
Mbur_0109         CDS       T00341                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mbu  Methanococcoides burtonii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mbu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mbur_0109 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mbur_0109 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mbur_0109 (trpA)
Enzymes [BR:mbu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mbur_0109 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
96560..97339
Genome map
AA seq 259 aa AA seqDB search
MRLADKFNEIKNRNETALLAYVCAGDPDIDSTPRIVDSLIKGGADIIELGLPFSDPVADG
PTIQAASERALTAGMNPDRYFELVANLDVQVPLVCMTYYNLIYKRGIEKFVKDCISSGIS
GLIIPDLPAEESADLANCCSQEGVDLIFLVAPITTDERIEMILSKTSGFVYIVSRSGVTG
TRSDVTAATSDIISRVRTDIPKAVGFGISNAEQAAKIIDAGADGVIVGSAFVDIIASGND
VEKRLEDLTAEIKSVCRRD
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgagattagctgataaattcaatgaaataaagaacaggaatgagacagcacttcttgct
tatgtttgtgcaggagatcccgatattgattcgaccccacgaattgttgattcgctgata
aagggtggtgcagatattattgagctgggattgccattctccgatccggtggcagacgga
cccaccatacaggcagcatcagaaagagcacttacagcaggaatgaacccggacaggtat
tttgaacttgtggcaaaccttgatgtgcaggtaccacttgtttgtatgacatattataat
ctgatatacaaacgcggaattgaaaaatttgtaaaggattgtataagttcgggcattagc
ggattgatcatcccggatctaccggcagaggaaagcgccgaccttgcaaactgctgctca
caagaaggagtagacctgatatttttggtagctccgatcactacggatgagagaatagag
atgatattgtctaagacttccggctttgtgtacattgtctcaagatcaggcgttacagga
acaaggtccgacgtcacagctgcgacctccgacataatttcaagagtcagaacagacatc
ccgaaggctgttggtttcggaatttccaatgcagaacaagctgcaaagatcatagatgca
ggtgcggacggagttatagtaggttctgcttttgtagatattatcgcatcaggaaatgat
gtcgaaaaaagactggaagaccttacagctgagatcaagtcagtctgtagaagggactga

DBGET integrated database retrieval system