KEGG   Methanococcoides burtonii: Mbur_0255Help
Entry
Mbur_0255         CDS       T00341                                 

Definition
thymidine phosphorylase (EC:2.4.2.-)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
mbu  Methanococcoides burtonii
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbu00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Mbur_0255
Enzymes [BR:mbu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Mbur_0255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
230876..232396
Genome map
AA seq 506 aa AA seqDB search
MQLKVQPIDVKVGKYKVILNTIDAKELGVHEGDRVRIKNHVTLTAIVDFTEDMISPGMIG
LYHEVKEALSKEWTETVEVFPAEKPKSTYIIRKTMDGQKLTKEEIDILVKDIVEENLAEI
EIAAFLTATYINDMTDDETEWLTRAMIDSGDKLEFDTHPIMDKHSIGGVPGNKISLLIVP
IVAANGLLIPKTSSRAITGAGGTADLMEILAPVEFDAAEIKRMTEEVGGVLVWGGATNIA
PADDKLIKVEYPLSIDPHCQMLASIMAKKGAIGADHVVMDIPTGPGTKIKNVQEGRKLAR
DLINLGDRLGMDVDCALTYGASPVGRTIGPALEVIEALKVLESFEGPNSLIEKSASLAGM
LLEMGNVAGKDKGYDLAIETLKNGKALTKFKEIIKIQGGNPDVTHKDISVGEFTEDIIAP
NNGYILEMDNKRLVQIARLAGAPNDKGAGILLHRKQGEPLKEGDPVMTIYAEKKSKLENA
VKSAKERPPFIVEGMMLERIQSFKEI
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgcaactaaaagtacaacccattgatgtcaaagtaggcaaatataaagtgatcctgaac
acaattgatgctaaggagctaggtgtccatgaaggagacagggtacgtataaagaaccac
gtgaccctaacagccatcgtagattttacggaagatatgatatcacctggcatgataggg
ttataccatgaagtgaaagaggcactgagtaaggaatggaccgagacggtcgaagtattc
cctgctgaaaaaccaaagtcaacctatattataagaaagacaatggatggacagaagctc
acaaaggaagagatagacatactcgtgaaggacattgtcgaagagaaccttgccgagata
gaaattgctgcattccttactgcaacatatataaacgacatgaccgatgatgaaaccgaa
tggcttacacgtgccatgatagattctggggacaagctggaattcgatacccatccaata
atggacaagcattccatcggaggagttcccggaaataagatctcattgctcatcgttccc
atagtagctgcaaacggattacttatcccaaagaccagctcaagggcaatcactggtgca
ggagggactgcagacctgatggagatacttgcacctgttgagttcgatgctgctgagatc
aagaggatgaccgaagaggttggtggcgtacttgtctggggtggtgctaccaatattgca
cctgcggatgataagctcataaaggtcgaatacccgctttcaattgacccgcattgccag
atgcttgcatccatcatggcaaagaaaggtgccattggtgcagaccatgtcgtaatggac
atacccaccggacccggtacaaagatcaagaacgtacaggaaggaagaaagctcgcaagg
gacctgatcaatcttggtgacaggcttggtatggatgtggattgtgctctgacctatggt
gcctcccccgtgggacgcactataggacctgcacttgaagtgatcgaggcattgaaggtc
cttgagagctttgagggaccgaacagcttgatagagaagagtgcatcacttgcaggaatg
cttcttgagatggggaatgtggctggcaaagacaagggatatgaccttgccattgagacc
ctgaagaacggaaaagcactgacgaagttcaaagagatcatcaagatacagggcggtaat
cctgatgtgacccacaaagacatttccgtgggagagttcactgaagatatcattgcccct
aataacggatatatacttgagatggacaacaagcgccttgttcagatcgcaaggctcgca
ggagcacctaatgacaaaggtgcaggaatacttttgcataggaaacagggagaacctttg
aaagaaggcgatcctgtgatgaccatttatgcagagaagaaatcaaaacttgaaaacgcg
gtcaagagcgcaaaggaaagaccaccgttcattgtagagggaatgatgctggagcgcatc
cagagtttcaaggagatataa

DBGET integrated database retrieval system