KEGG   Methanococcoides burtonii: Mbur_0360Help
Entry
Mbur_0360         CDS       T00341                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
mbu  Methanococcoides burtonii
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:mbu00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Mbur_0360
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Mbur_0360
Enzymes [BR:mbu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Mbur_0360
Two-component system [BR:mbu02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Mbur_0360
Bacterial motility proteins [BR:mbu02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Mbur_0360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
339580..340635
Genome map
AA seq 351 aa AA seqDB search
MIKTLVVDDSALMRRAIRDMLESADDIEVIGTAKNGKEAVENTNKLKPEVIVMDVNMPIM
DGLAAVKAIMKTTPIPIIMFSSLTKKGSIEALEALRLGAIDFITKPSGLQEISKIENELV
TKVRNLYNSNVNIIRLLNLKKFKGEVINGNWNCPDQNLGILIGSSTGGPSSLEQIIPRLP
GDLPASVFIVQHMPEGNFCSQLAARLDAISELEVKEAENNEKVKIGVAYIAPGGYHMEIR
KALDVTRIKIIKGKPMHAVMPSVDVTVESFVKVYGNNSVAIILTGMGVDGASGFKKINES
NGATIACSEDTCVVFGMPKAAIEAGAIDVVKPIFEIPEQIVRMIEVKCNGN
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaactcttgttgttgatgattctgccttaatgagaagggcaataagagatatg
cttgagagtgctgacgatatagaagttatcgggactgcaaaaaatggcaaagaagccgtt
gaaaatacaaataagttaaagccggaagttatagtaatggatgttaatatgcccatcatg
gatgggctggcagctgttaaagctataatgaaaacaactccgatacccattataatgttt
agctctctcaccaagaaaggttcaatagaagctctggaagctttgagacttggagcaatt
gattttataacaaaacccagtggcttacaagagataagtaagatcgaaaatgagctagta
acaaaagttcgcaatctctacaattcaaatgtaaatattatacgattacttaacctgaaa
aaattcaagggtgaagtaataaatggaaactggaattgtcctgatcaaaatctgggaata
ctaattggttcttctacaggtggcccttcttctcttgaacaaataattccaagattgcca
ggtgatctaccagcatcggtttttatagtacagcatatgccagaaggtaatttttgcagc
cagctagctgcaagattggatgctatatcagaacttgaagtaaaagaagctgaaaataat
gagaaagtaaaaattggagttgcttatatcgctcctggcggatatcacatggaaattcgg
aaggccttggatgtaactagaataaaaatcataaaaggtaaaccgatgcatgctgttatg
ccttctgtcgatgtaactgtagaaagtttcgttaaagtgtatgggaataactcagtcgcc
ataatacttacgggaatgggggtcgatggagcatccggattcaaaaaaataaatgaatca
aatggagccaccatagcatgcagtgaagatacttgcgttgtttttgggatgccaaaggct
gctatcgaagccggagcgattgatgttgtaaaacctatttttgaaatacctgaacaaatt
gttaggatgatagaggtgaaatgcaatggaaactga

DBGET integrated database retrieval system