KEGG   Methanococcoides burtonii: Mbur_0360Help
Entry
Mbur_0360         CDS       T00341                                 

Definition
(GenBank) Chemotaxis response regulator protein-glutamate methylesterase CheB
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
mbu  Methanococcoides burtonii
Pathway
mbu02020  Two-component system
mbu02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:mbu00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Mbur_0360
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Mbur_0360
Enzymes [BR:mbu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Mbur_0360
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     Mbur_0360
Two-component system [BR:mbu02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Mbur_0360
Bacterial motility proteins [BR:mbu02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Mbur_0360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest Response_reg
Motif
Other DBs
NCBI-ProteinID: ABE51355
JGI: Mbur0360
UniProt: Q12YX1
Position
339580..340635
Genome map
AA seq 351 aa AA seqDB search
MIKTLVVDDSALMRRAIRDMLESADDIEVIGTAKNGKEAVENTNKLKPEVIVMDVNMPIM
DGLAAVKAIMKTTPIPIIMFSSLTKKGSIEALEALRLGAIDFITKPSGLQEISKIENELV
TKVRNLYNSNVNIIRLLNLKKFKGEVINGNWNCPDQNLGILIGSSTGGPSSLEQIIPRLP
GDLPASVFIVQHMPEGNFCSQLAARLDAISELEVKEAENNEKVKIGVAYIAPGGYHMEIR
KALDVTRIKIIKGKPMHAVMPSVDVTVESFVKVYGNNSVAIILTGMGVDGASGFKKINES
NGATIACSEDTCVVFGMPKAAIEAGAIDVVKPIFEIPEQIVRMIEVKCNGN
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaactcttgttgttgatgattctgccttaatgagaagggcaataagagatatg
cttgagagtgctgacgatatagaagttatcgggactgcaaaaaatggcaaagaagccgtt
gaaaatacaaataagttaaagccggaagttatagtaatggatgttaatatgcccatcatg
gatgggctggcagctgttaaagctataatgaaaacaactccgatacccattataatgttt
agctctctcaccaagaaaggttcaatagaagctctggaagctttgagacttggagcaatt
gattttataacaaaacccagtggcttacaagagataagtaagatcgaaaatgagctagta
acaaaagttcgcaatctctacaattcaaatgtaaatattatacgattacttaacctgaaa
aaattcaagggtgaagtaataaatggaaactggaattgtcctgatcaaaatctgggaata
ctaattggttcttctacaggtggcccttcttctcttgaacaaataattccaagattgcca
ggtgatctaccagcatcggtttttatagtacagcatatgccagaaggtaatttttgcagc
cagctagctgcaagattggatgctatatcagaacttgaagtaaaagaagctgaaaataat
gagaaagtaaaaattggagttgcttatatcgctcctggcggatatcacatggaaattcgg
aaggccttggatgtaactagaataaaaatcataaaaggtaaaccgatgcatgctgttatg
ccttctgtcgatgtaactgtagaaagtttcgttaaagtgtatgggaataactcagtcgcc
ataatacttacgggaatgggggtcgatggagcatccggattcaaaaaaataaatgaatca
aatggagccaccatagcatgcagtgaagatacttgcgttgtttttgggatgccaaaggct
gctatcgaagccggagcgattgatgttgtaaaacctatttttgaaatacctgaacaaatt
gttaggatgatagaggtgaaatgcaatggaaactga

DBGET integrated database retrieval system