KEGG   Methanococcoides burtonii: Mbur_0399Help
Entry
Mbur_0399         CDS       T00341                                 

Definition
MCP methyltransferase, CheR-type
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
mbu  Methanococcoides burtonii
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:mbu02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:mbu02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
378853..381315
Genome map
AA seq 820 aa AA seqDB search
MTFHIVGIGASAGGLEAIAEFFENMPHNSGMAFIVVQHLSPDYKSLMVEILSKHTQMEVL
RAEEGMLVEPNKVYLIPPKKNLSIFNQRLLIEQSSSTLPNYPVDILFRSLAQDQAEKAIA
IILSGTGSDGSLGIHHIKENGGIVIVQNPESAKLSGMPENAISTELVDFILTPAQMPSQL
ISFIDHPPVTNNNHEDLLLISPNEFDIILSILRNRNNFDFSEYRSNTILRRIERRMIMNQ
VTNLKDYIMILQNNPSEATVLHKEILIGVTSFFRDESAFDELQNKWLPILFSEKKDKNLR
LWVVGCSTGEEAYSVAIVLKELMDKLNNYFNVKIFATDINQEAINSASVGFFPKSILGNI
SSERLSKYFVPKDSGFQISRDIRQMVIFAQHDIIKDPPFNNIDMITCRNMLIYMQPVLQT
KVLDLLNYSLKKKGILFLGSCETSGALVEYFETLSSKWKIYSSKGRTKQIDAKRMYAKTI
TFPDKEKQVSINIYKDSSYMQEDKLIKRLLSILPDKYLPLTAVVGSDMTLRYLVGNSEDY
FKLPAGKLEYNITKMVPKELIIPLSTGLKKVFQNEEDLSYNNIHFKSKNNTQYIKLNLKL
LPHKFGEEALAAVFFEEINSDKGNNFNDVNLEYDIGRETKQHINDLEQDLLLTKETLHAA
IEELETSNEELQSTNEELLASNEELQSTNEELHNVNSEYQLKIIELTELNNDFKNLLSTV
QIGTLFLDENLNVRKFTAPMDNLFALDNSDIGKSIYNLKNKTTVEDLVNKFVQVHKTIKS
QEIEVKTKDGIEFELKIIPYDIGQNNYSGVMITALDKTCK
NT seq 2463 nt NT seq  +upstreamnt  +downstreamnt
atgacatttcacattgttggcattggggcttctgctggtggacttgaggcgattgcagag
ttttttgagaacatgcctcacaattccggaatggcatttattgtagttcaacacctttca
ccggactacaagagcttaatggtagagatcctttcaaaacatacgcaaatggaagttctt
cgtgcagaagaaggaatgctagttgaacctaataaggtatacttaatcccacccaaaaag
aacctatcaatatttaatcaaagacttttaatcgaacaaagtagcagtactctgccaaat
tatcctgtcgatatattgtttcgttctcttgcacaagaccaggctgaaaaagctatagct
ataattttatcaggaacagggagcgatggctctcttggtattcatcacatcaaagagaat
ggtggaattgtaatagtacaaaatccagaatcagcaaagttaagtggaatgccagaaaat
gcaatatccacagagcttgttgattttatacttacaccagcacaaatgccatcacaatta
atttcatttatagaccatccacctgtaactaataataatcatgaggatttattattaata
tctccaaatgaattcgatattattttatctatactccgtaatagaaataatttcgacttt
agtgaatatcgatcaaatacgatcttaagaagaatagagcgtagaatgataatgaatcag
gttaccaacttaaaagattatattatgatcttacaaaataatccaagtgaagcaacggtt
cttcacaaagagattttgataggtgttacaagctttttccgtgatgaaagtgcttttgac
gagttacagaataaatggctacctattttgttttctgaaaaaaaggacaaaaatcttcga
ctatgggtcgtggggtgttctacaggtgaggaagcatatagcgttgcaattgtactaaaa
gaattgatggacaagttgaataactactttaatgttaaaatattcgcaactgatattaat
caagaagccataaatagtgcttccgttggtttttttccgaaaagtatacttggtaacatc
tctagtgaaaggctatcgaaatattttgttccaaaggactcaggtttccagatttcgaga
gatatcaggcaaatggttatatttgcacaacatgatataataaaagatccaccatttaac
aatatagatatgatcacttgccgtaacatgcttatctatatgcaacctgtacttcaaaca
aaagttcttgatcttttaaattattcattaaagaaaaaaggtatactttttttgggatca
tgtgagacgtccggagcacttgtcgagtactttgaaaccttaagtagcaaatggaaaatc
tatagttcaaaaggacgtacaaaacaaattgatgcaaaaaggatgtatgcaaaaacaatc
acgtttccggataaagaaaaacaagtttctataaatatatataaagactcttcttatatg
caagaagacaaacttattaaaaggttattatcaatcctgccggataaatatttaccttta
actgctgttgtcggaagtgatatgactctccggtatttggtaggcaactctgaagattac
ttcaaattaccagctggcaaattggaatataacataactaaaatggtacctaaggaacta
ataattcctctgtcaacaggccttaaaaaagtattccaaaatgaagaagacttgagctat
aacaatatacactttaaatcgaaaaataatactcagtacataaagttgaatctgaaactt
cttccccataaatttggtgaagaagcactcgctgcagttttctttgaagagattaactct
gacaagggtaacaatttcaacgacgttaatttagaatatgatattggtagggaaacgaaa
cagcacataaatgatcttgaacaagacctactgcttaccaaagagacacttcatgcagct
attgaagaacttgaaacttcaaacgaagagttacagtcaactaatgaggaattgcttgcc
agcaacgaagagcttcaaagtacaaacgaagaattgcataatgtaaattcagaatatcaa
ttaaaaataattgaattgacagaacttaacaatgattttaaaaatcttctttcaactgta
cagattggtacgcttttcctcgatgaaaatttaaatgttagaaaatttacagcaccaatg
gataatttatttgctcttgataacagtgatattggcaaatctatctataacctaaaaaat
aaaacgactgttgaagatctagtaaataaattcgtacaggttcacaaaactataaaatct
caagaaatagaagttaaaacaaaagatggaatagaatttgaattaaagataattccttat
gatatcggacaaaacaactattcgggagttatgattactgctcttgacaagacttgcaaa
taa

DBGET integrated database retrieval system