KEGG   Methanococcoides burtonii: Mbur_0457Help
Entry
Mbur_0457         CDS       T00341                                 

Definition
(RefSeq) L-threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mbu  Methanococcoides burtonii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mbu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mbur_0457
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mbur_0457
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Mbur_0457
Enzymes [BR:mbu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Mbur_0457
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(450229..451572)
Genome map
AA seq 447 aa AA seqDB search
MKLYSTNLKADEVSFETALITGLAPDKGLYMPKDLPHFSEEELSSLKDEPYPEIAFRLLS
RILEGEIDEASLKEITYDAYDYDVPLEEVDENTYIMRLDRGPTASFKDFAARMMARLMQF
YLKKENKNLTILTATSGDTGSAVAHAFYDLDNIKVIVLFPETEVSERQRKQMTTLDGNIS
AIAMDGKFDDCQALVKQAFADPDLKHLNLSSANSINIGRLIPQSIYYFYAYLKLREFPEE
IIYSIPSGNFGNMMGCVLAKRMGVPIKKILASVNENDEVPVFFNTGEYSKIEPSKNCISN
AMNVGHPSNLARLVTIYGGEMDETGHITKMPDMDVLNNDIFSTSVTDEETTAIVKEFYED
YGIFIEPHGAVGIKGLLDYRAASNDDTLAVTLETAHPAKFPKEVMSAIGVDPEPPQTLKD
VESREEFMESMGADYEQFKNYLKEKLD
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgaaactctatagtaccaatctcaaagcagacgaagtatctttcgaaactgctcttatt
acaggtcttgctccggataaaggcctttatatgcccaaagatctccctcatttctcagag
gaagagcttagttccctaaaagatgaaccatatcccgagatagcctttaggctgctcagc
aggatccttgaaggtgagatcgatgaagcatcattgaaagagataacatatgatgcttac
gattacgatgttcctctcgaggaagtggatgagaacacttatataatgagacttgaccgt
ggtcccactgcttcattcaaggactttgctgctcgcatgatggcaaggctgatgcagttc
tatctcaaaaaagagaacaagaacctgacaattctaacggctacttccggagataccggc
agtgctgtagctcatgcattctacgatcttgacaacataaaggtgatcgttctattccct
gagactgaagtatcagaacgtcagagaaagcagatgacgaccctggatggcaacatctct
gccattgcaatggatgggaagttcgatgactgtcaggcattggtcaaacaggcttttgca
gatcctgaccttaagcatctgaacctttcatcagcaaattctatcaacattggcagactt
atcccccagtcgatctactatttctatgcttaccttaagcttagagagttcccggaagag
atcatctattccattccttctggaaatttcggtaacatgatgggatgtgtgctcgcaaag
agaatgggagtgccaatcaagaagatacttgcttctgtgaatgagaacgatgaggtgcct
gtttttttcaacacaggtgagtactccaagatcgaaccttcaaaaaactgtatctcaaat
gcaatgaatgtcggtcatccaagcaatcttgccagattggtgacaatatatggtggtgag
atggatgagaccggccacataactaagatgcctgatatggatgttctcaataatgatatc
ttctctacatcagttaccgacgaagaaacaacggctattgtaaaggaattctatgaggat
tatggtattttcattgaaccccatggagcagtcggaataaagggacttctggattacagg
gcagcttctaatgacgatacactggctgtaacactcgagaccgctcacccggcaaagttc
cctaaagaagtgatgtctgcaataggtgtcgatcctgaaccaccccagacactcaaggat
gtcgagtcaagagaggaatttatggaatctatgggagctgactatgagcagttcaagaat
tacctgaaggaaaagcttgactaa

DBGET integrated database retrieval system