KEGG   Methanococcoides burtonii: Mbur_0608Help
Entry
Mbur_0608         CDS       T00341                                 

Definition
(GenBank) Acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mbu  Methanococcoides burtonii
Pathway
mbu00010  Glycolysis / Gluconeogenesis
mbu00620  Pyruvate metabolism
mbu00640  Propanoate metabolism
mbu00680  Methane metabolism
mbu00720  Carbon fixation pathways in prokaryotes
mbu01100  Metabolic pathways
mbu01110  Biosynthesis of secondary metabolites
mbu01120  Microbial metabolism in diverse environments
mbu01130  Biosynthesis of antibiotics
mbu01200  Carbon metabolism
Module
mbu_M00357  Methanogenesis, acetate => methane
mbu_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mbu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mbur_0608
   00620 Pyruvate metabolism
    Mbur_0608
   00640 Propanoate metabolism
    Mbur_0608
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mbur_0608
   00680 Methane metabolism
    Mbur_0608
Enzymes [BR:mbu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Mbur_0608
Lipid biosynthesis proteins [BR:mbu01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Mbur_0608
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ABE51579
JGI: Mbur0608
UniProt: Q12Y97
Position
complement(622766..624370)
Genome map
AA seq 534 aa AA seqDB search
MSSLLEEYVSRTDFGSYEDFKKNFKINIPENFNFAYDVVDRYAMEQPDKRALVWCDDNGN
ELVYTFKDLKHYSDKAANLFKKYGIEKGDVVMLTLKGRYEFWICILALHKIGAVALPATH
MLTTKDVTYRIELSNIKMVVSADDEGLMGYIDEGHKGYEDILLHKASLNGGREGWLDFTK
ELEEASADFTRPEGEAATKNEEIALLYFSSGTTGLPKMVQHDFAYPLGHIITAKYWQNVR
DDGLHLTVADSGWAKCVWGKLYGQWISGTAVFVYDYERFDAKNMLEFASKYGVTTFCAPP
TIYRFLIKEDLSQYDFSSLEYCVVAGEPLNPEVYERFLEFTGLKLMEGFGQTESIVSIAT
YPWMEPKPGSMGKPSPEYDIELLNLDDEVCDFGEEGEIVINTSKGKTVGLFAGYRSDEKK
TNEVWHDGYYHTGDMAWKDEDGYFWFVGRSDDIIKSSGYKIGPFEVESALIEHPAVLECA
ITGVPDATRGQIVKATIVLAKGYVASEELKKQLQDHVKKATAPYKYPRAVDFVD
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgtcatctttattggaagaatatgtctcacgtacagattttggatcatatgaggacttt
aagaaaaatttcaagatcaacattcctgaaaatttcaatttcgcatacgatgtcgtcgac
agatatgcaatggaacagcctgataaaagagcacttgtctggtgtgatgataacggcaat
gaactggtctataccttcaaggacctgaaacactatagtgacaaagctgctaatctgttc
aaaaaatacggtatcgaaaaaggcgatgttgttatgctgacccttaaaggtcgatatgag
ttctggatatgtatccttgctttgcataagatcggtgcggtagcccttcctgcaacacat
atgctgaccacaaaggatgtcacataccgcatcgaactttccaatataaagatggtagtc
agtgcggatgatgaagggttgatgggatatattgatgaaggtcacaaaggctatgaggat
atcctgctccacaaggcatctctgaatggaggacgtgaagggtggctggatttcacaaag
gaactggaggaagcttctgctgacttcacacgtccggaaggagaagctgctacaaagaac
gaggaaattgcgttgctttatttctcctcaggtaccacaggactgccaaaaatggtgcag
cacgattttgcatatcctctcggtcatatcatcactgcgaagtactggcagaacgtccgc
gatgatggtctgcaccttacagttgctgattccggctgggcaaagtgtgtgtggggtaag
ctctacgggcagtggataagcgggactgcggtctttgtctatgactatgagcgttttgat
gctaagaacatgcttgagtttgcaagcaagtatggggtaaccaccttctgtgcacctccg
acgatatatcgtttcctgatcaaggaagacctttcacaatatgatttcagcagtctcgag
tattgtgttgtagcaggcgaacctcttaatcctgaagtttatgagaggttcctggagttc
accggacttaagctcatggaaggcttcggtcagaccgagagcattgtaagcattgctact
tatccgtggatggaacctaaacccggttcaatgggcaagccttctcctgaatacgatatc
gagcttttgaaccttgatgacgaagtctgtgatttcggagaagagggcgagatcgtcatc
aatacctcaaaaggaaaaacagtaggtttgttcgcaggatatcgttctgatgaaaagaag
actaacgaggtatggcatgatggttattaccataccggagatatggcctggaaggacgag
gatggttatttctggttcgttggcagatctgatgatatcatcaagagctccggttacaag
atcggacctttcgaggtagagagcgctttgatagaacatcctgctgtacttgaatgtgct
atcacgggtgttcctgatgctacaagagggcagatagtcaaagctacgatcgttcttgca
aaaggctatgtagcaagtgaggaattgaagaagcaacttcaggaccacgtcaagaaagct
actgcaccttacaagtatccacgtgctgtggattttgttgattag

DBGET integrated database retrieval system