KEGG   Methanococcoides burtonii: Mbur_0712Help
Entry
Mbur_0712         CDS       T00341                                 

Definition
(GenBank) Archaeal aminopeptidase or endoglucanase M
Organism
mbu  Methanococcoides burtonii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(736342..737394)
Genome map
AA seq 350 aa AA seqDB search
MELEKLLEKLSNAHGISGYENNVKQIMEDEIRPYVDETRTDKMGNLIATKKGDGPTVMLA
AHMDEIGLMVQYIDDKGFLHFVMIGGWFDQTLHSQRVIVHGSNAQLTGVIGSKPPHVMKE
EDRNKPVKAEDMFIDIGAKDKEDAMKMGVDVGTAISMDRDFATLANGLVTCKAFDNRAGV
AMLIDAMKQISETKVNATIYAVGTVQEEVGLKGARTSAFGLNPDVAIAVDVTFPGDHPGI
SKNDSALEMGKGAVITVVDASGRGLIADKNVVKWLKETAEENDIPYQLNVGCGGTTDATA
IHLTREGIPSSTISVPTRYIHSPVEVLSLEDLRSCADLIAKAVQNIDKYF
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggaacttgagaaactacttgaaaaattatctaatgcacatggaatatcagggtatgag
aataacgtcaaacagataatggaagacgagatcagaccatacgttgatgagaccagaaca
gataagatgggaaatctcatcgccacaaaaaaaggtgatggacctacggtcatgctggca
gcacacatggatgagatcggcctgatggtgcaatatattgatgacaagggattcctgcac
tttgtgatgatcggcggctggttcgaccagacactacacagccagagagtcatagtccac
ggaagcaatgcccagcttacaggtgttatcggctcaaagccaccacatgtgatgaaagag
gaagacagaaataaaccggtaaaggcagaggacatgttcattgatatcggggcaaaggac
aaagaagatgccatgaagatgggagtggatgtaggaaccgccatatcaatggacagggat
tttgcaaccctcgccaacggcctggtcacatgtaaagcattcgacaacagggcaggagta
gcaatgctcattgatgccatgaagcagatatccgaaacaaaagtaaatgcgaccatatat
gccgtagggacagttcaggaagaggtcgggctcaaaggtgcacgcacatctgccttcgga
cttaatccggatgtcgccattgcagtagatgtaacattccccggagaccatcccggaata
agcaagaacgattctgcactggaaatgggaaaaggtgccgtcatcacagtcgttgatgca
tccggcagaggacttattgcggacaaaaacgtagtaaaatggctaaaagagaccgctgaa
gagaacgacataccataccagctcaatgtaggttgtggcggaacgaccgatgcgactgcg
atacatctcacaagagaaggtatcccctcaagcacaattagcgtacctacaagatacatc
cactcacctgtggaggtcctatcccttgaagacctgagatcctgtgccgatctcatagca
aaagctgttcagaacattgacaagtatttctga

DBGET integrated database retrieval system