KEGG   Methanococcoides burtonii: Mbur_0967Help
Entry
Mbur_0967         CDS       T00341                                 

Definition
(GenBank) nucleoside kinase
  KO
K22026  
nucleoside kinase [EC:2.7.1.73 2.7.1.213 2.7.1.-]
Organism
mbu  Methanococcoides burtonii
Pathway
Purine metabolism
Pyrimidine metabolism
Brite
KEGG Orthology (KO) [BR:mbu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Mbur_0967
   00240 Pyrimidine metabolism
    Mbur_0967
Enzymes [BR:mbu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.73  inosine kinase
     Mbur_0967
    2.7.1.213  cytidine kinase
     Mbur_0967
    2.7.1.-  
     Mbur_0967
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1050262..1051164)
Genome map
AA seq 300 aa AA seqDB search
MSDSISVVGHAAIDFLFDVEGISGPNESNPIVDYQRFYGGGAANIVAAISILGGRSQLIS
AVGDDFSTSGYESYLESLGVDLSLLFRLKGEKGTAAYVFTDPFHNQSTYFYWGASAKLKE
LEPPEVDFVHLATSESNFNAKIAKKAKFVSFDPGQDLVTYTRENLEIVLENTDILFTNKY
EIKRVCEMTESTFEDIRAQIDVVVVTYDADGSKIFTADAEHEIPIVPVNALDPTGAGDAY
RAGFLVSYRRGYPLDSCGRVGATVASFAVGSVGCQTDLPTWDDMVVRYESHFGAFPSLDG
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgtctgattccatctctgttgtgggccacgcagcgatagactttctttttgatgtggaa
ggtatttcaggtcccaatgaatcaaatcctattgtggactatcagcgtttttatggtggt
ggggcggctaatatcgttgcagctatctctatccttgggggaagatcccaactgatctct
gctgtgggtgatgatttctcaacatctggctatgagagctaccttgagtctttaggtgtc
gatctttcactgcttttcaggcttaaaggtgaaaaaggaacggcagcatatgtttttact
gatccttttcataatcagtccacttacttttattggggtgcttctgcaaaactgaaagag
ctggaaccccctgaggtggattttgtccatttagctacttctgagtctaatttcaatgca
aagatcgcgaaaaaagcgaagttcgtgtcttttgatccgggacaggaccttgtgacctat
acaagggagaatcttgaaattgttcttgagaacactgatattcttttcactaacaagtat
gagataaagcgggtatgtgagatgaccgaaagcacttttgaggatatcagggcgcaaatc
gatgttgtcgttgtcacttatgatgctgatggtagcaagatattcactgcggatgccgaa
catgagattcctatagttcctgtaaacgcactcgatcctacaggtgcaggagatgcttat
cgtgcgggtttccttgtatcttacaggcgcggttatcctctggattcatgtggcagggta
ggtgcaacggttgcttcctttgcagtagggtcagttgggtgtcagaccgatcttccgaca
tgggatgatatggttgtcaggtacgaaagtcattttggagcatttccatctttggatggt
taa

DBGET integrated database retrieval system