KEGG   Methanococcoides burtonii: Mbur_1038Help
Entry
Mbur_1038         CDS       T00341                                 

Definition
nitrogenase iron protein subunit NifH (EC:1.18.6.1)
Orthology
K02588  
nitrogenase iron protein NifH [EC:1.18.6.1]
Organism
mbu  Methanococcoides burtonii
Pathway
Nitrogen metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:mbu00910]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1120382..1121176
Genome map
AA seq 264 aa AA seqDB search
MSVQKRIAIYGKGGIGKSSTASNVAAACADEGYTVMIIGCDPKSDSSITLLGGKRIPTIL
DLLRKEKDVKEEDVVFTGYNGVKCVEVGGPEPGIGCAGRGIIVAIQTLKKISKTLNEMDL
IIYDVPGDIVCGGFVAPIRKGLVKEAYVLTSGEYMPLYAANNICRGLAKINTPLSGIICN
SRSVSREKEIVTKFASEIGTDLMAFIPKEQIVQDCERDGFSVMEKAPDSSIAQVYRDLAK
AIMQRDTSVMPVALDDERLRELTR
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtacagaaaagaatagctatctatggaaaaggtggcatcggaaaatccagtact
gcatccaacgttgcagccgcatgtgccgatgagggatacacggtaatgataattggctgt
gacccgaaaagcgattcatccatcacccttcttggaggaaaacgcatcccgaccatcctt
gatcttctgcgtaaggaaaaggatgtgaaagaggaagatgtcgtatttaccggttacaat
ggcgtgaagtgtgtggaagtgggcggacccgagccaggtatcggctgtgccggacgtggg
atcatcgtggccatccagacacttaagaagatatcaaaaacgctgaacgaaatggacctt
atcatctacgatgtccctggagatatcgtatgtggtggctttgtagcacctatacgcaag
ggacttgtaaaggaagcatatgtcctgacttccggcgaatatatgcccctttatgcagcg
aacaatatctgccgaggactggcaaagataaacactcccctcagcgggatcatatgtaat
tcccgcagtgtgagccgtgaaaaagagatagtgaccaagttcgcaagtgagataggaacc
gaccttatggcgttcataccaaaggaacagatcgtgcaggattgcgaaagggatggtttc
tcggtcatggaaaaagcaccagactccagcattgcacaagtttatcgtgaccttgcgaag
gccatcatgcaacgcgatacttccgttatgcctgttgctcttgacgatgaacgtctcaga
gagcttaccagataa

DBGET integrated database retrieval system