KEGG   Methanococcoides burtonii: Mbur_1100Help
Entry
Mbur_1100         CDS       T00341                                 

Gene name
trpB2
Definition
(GenBank) Tryptophan synthase beta chain 2 (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mbu  Methanococcoides burtonii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mbu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mbur_1100 (trpB2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mbur_1100 (trpB2)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mbur_1100 (trpB2)
Enzymes [BR:mbu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mbur_1100 (trpB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1179980..1181284
Genome map
AA seq 434 aa AA seqDB search
MEQTKILLDENEMPKKWYNILPDMPTPLAPPLNPANNEPLAPEDLAPLFPMELIKQEMSS
EKYIDIPKEVLEIYKLWRPAPLFRAHRLEKMLDTPAKIYYKYEGVSPAGSHKPNTAVAQA
YYNMKEGTERITTETGAGQWGSALSLSCNYFDIECKVYMVRSSFEQKPYRKSLINLWGAT
VVPSPSPDTEFGRHILEKYPDTAGSLGIAIGEAVEDAVKHDNTKYALGSVLNHVMLHQTV
IGIEAQKQLDKVEEYPDIVIGCCGGGSNLAGISLPYMKDKIEGTHDPRIIAVEPSACPTL
CDGKFQYDYGDMAKLTPLLKMYSLGYDFMPPAIHAGGLRYHGCSPIISQLTADKLMEATS
YHQIEVFEAGVMFARSEGIPPAPESNHAIKCAIDEALKCKQTGEEKTILFCLSGHGHFDM
YSYDKYFSGGLSNE
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atggaacagactaagatcctacttgatgaaaacgagatgcctaaaaaatggtataatatc
cttccggatatgcccactccattggctcccccacttaatcctgcaaataatgagccactg
gcaccagaggaccttgcgcctcttttcccaatggagctcatcaaacaggaaatgagcagt
gagaaatacattgacattccaaaagaagttcttgaaatatacaagctctggagacctgct
cctttattccgtgcacacaggcttgagaagatgcttgacacccctgcaaagatctattat
aagtatgaaggagtaagtcctgctggcagtcacaagccaaatactgctgtggcacaggct
tattataatatgaaagaaggcactgagaggataactaccgagaccggagctggtcagtgg
ggaagtgcactttcacttagctgtaattattttgatatcgaatgtaaggtctacatggta
cgctcaagcttcgagcagaaaccataccgtaaatccctgatcaatctctggggtgcaaca
gtagtaccttcgccaagtcctgatactgagttcggacgtcacatacttgaaaaatatccg
gacactgcaggcagtcttggtattgctataggtgaagctgtagaagatgccgtgaagcac
gacaatactaaatatgctcttggcagtgtgctcaaccacgtcatgttgcatcagacagtt
ataggtattgaagcccagaaacagcttgataaggtagaggaatatccagatatagtcatc
ggttgctgtggtggtggaagtaaccttgcaggaatcagccttccctacatgaaggataag
atcgaaggtactcatgatccgcgtatcattgctgtcgagccttctgcatgtccaacactt
tgtgacggcaagttccagtatgactatggcgacatggcaaaactgaccccactccttaag
atgtattcactcggttatgatttcatgccacctgccatccatgcaggaggcttaagatac
cacggctgctcaccgataatcagtcagttgacggcagataaactcatggaagctaccagc
tatcatcagatcgaggtattcgaagcaggagtcatgttcgctcgcagtgaaggtattcca
ccagcaccagagtcaaaccatgctattaagtgcgctattgatgaggctctcaagtgcaag
cagaccggagaagagaagaccattctgttctgccttagtggacacggtcacttcgatatg
tattcctacgacaagtatttcagtggtggactcagcaacgaatga

DBGET integrated database retrieval system