KEGG   Methanococcoides burtonii: Mbur_1103Help
Entry
Mbur_1103         CDS       T00341                                 

Definition
(GenBank) Histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
mbu  Methanococcoides burtonii
Pathway
mbu00340  Histidine metabolism
mbu01100  Metabolic pathways
mbu01110  Biosynthesis of secondary metabolites
mbu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mbu00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Mbur_1103
Enzymes [BR:mbu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Mbur_1103
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ABE52031
JGI: Mbur1103
UniProt: Q12WZ5
Position
1184434..1185714
Genome map
AA seq 426 aa AA seqDB search
MLYKHLSEVTDEEMEKLLCRTGDMMDVAGTVSSILKDVQEKGDEGLREYTLKFDKADIHT
IEVSSEEIEQAMKEVDAELLRHLKIAAENIRNFHTAQLPQKTWYIEPSPGIKLGQMATPL
ASVGAYVPGGRASYPSTALMTIIPAKVAGVKNVVMCTPPGSDGKVNPLTLVAGKVAGADH
IYKVGGVQAIAAMAYGTESVLSVDKIVGPGNVFVTVAKMMVRDKAEIDFPAGPSEVLIIA
DDSADAAMIASDILAQAEHDPKSVSVLVTTSSELAEQTNNEVKKQAAIAVRREIIEQSLE
NAAILVTDSMDECIRISNDFAPEHLEIMVEDDDAVLDMIENAGSIFVGNYAPVAAGDYAS
GTNHVLPTAGYPKIYSGLNIHHFLKYSTIQKITKEGLSSIGDTIIALAEKEGLQAHADSV
KSRLMS
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgctgtataaacacctatcggaagtcactgacgaagagatggagaagctcctctgccgc
actggagatatgatggacgttgctggtactgtttcatcaattctaaaggatgtgcaggag
aaaggcgatgaaggcctgcgtgaatatactttgaagtttgacaaggccgatattcatacc
attgaggtaagttctgaggagatcgagcaggcaatgaaagaggtcgatgcagaacttctc
agacatcttaagatcgcagcggagaacataaggaacttccacacagcacaacttccacag
aagacctggtacattgaaccgtctcccgggatcaaacttggtcagatggccactccacta
gcatcggtaggtgcctatgttccgggtggtcgtgcttcttatccttcaactgcacttatg
accataatccctgcaaaggtcgcaggggtaaagaatgttgtgatgtgcactcctcccggt
tctgatgggaaggtaaatccacttactcttgtagcaggcaaagtggctggtgcagatcat
atctataaggtcggtggagttcaggcgatcgcagcaatggcctacggtactgaatcagta
ttaagcgtcgacaagatcgttggacctgggaatgtctttgtgaccgttgccaagatgatg
gttcgggataaagcggagatcgatttccccgcaggtccaagtgaagtgcttattattgca
gatgattctgcggatgctgctatgatcgcatctgatattcttgcacaggcagagcacgat
ccaaaatcggtgtcagttcttgtgacaacatcctctgaactggcagaacagaccaacaac
gaggtcaaaaagcaggctgctattgctgtgcgcagggagatcattgagcaatctcttgag
aatgcagctattctcgtgacagattccatggatgaatgtatcaggatctccaatgatttt
gcaccggaacacctcgagatcatggttgaagatgatgatgcggttctcgatatgatcgag
aatgcaggttctatctttgtcggtaattatgctccggttgcagcaggtgattatgcatcg
ggtacaaaccatgtacttccaacagccggttatcctaagatatattcaggtttgaatatt
caccatttcctgaaatattccaccatacagaagatcacgaaggaaggcctaagctccatc
ggagatacgataatagcccttgctgaaaaagagggtttacaggcacatgctgattctgtt
aagtctcgtcttatgtcttga

DBGET integrated database retrieval system