KEGG   Methanococcoides burtonii: Mbur_1137Help
Entry
Mbur_1137         CDS       T00341                                 

Definition
(RefSeq) acetyl-coenzyme A synthetase (EC:6.2.1.1)
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mbu  Methanococcoides burtonii
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Methanogenesis, acetate => methane
Methanogen
Brite
KEGG Orthology (KO) [BR:mbu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mbur_1137
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mbur_1137
   00620 Pyruvate metabolism
    Mbur_1137
   00640 Propanoate metabolism
    Mbur_1137
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mbur_1137
   00680 Methane metabolism
    Mbur_1137
Enzymes [BR:mbu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Mbur_1137
Lipid biosynthesis proteins [BR:mbu01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Mbur_1137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1222356..1224245)
Genome map
AA seq 629 aa AA seqDB search
MSEKFDVKLDSKSYFPDPSVKENSWMQDYEKVYSESLKDPEKHWENVAEELEWFEKWDKV
MEWDHPYAKWFTNAKMNITHNCLDRHVFNGRRNKVAMIWVGDNGEEQVITYRQLYRDVMR
FSNGLKSLGVGKGDTVCIYMPQVPEQIVAMLACARIGAIHSVVFGGFGAKALHSRIKDAQ
AKVVITADASIRRGKRIDLKSLVDEAVVNASCVEKIVVLRRMTPQIELFSEIEVDFYEIM
EDVEKECEPEIMDSEDPLFILYTSGTTGPAKGIVHTCGGYMVGTYYTTKNVLDLKDNDVL
WCTADPGWITGHSYIVYGPLSMGATILISETTPDYPDPGVWWSMIEEFDVSVFYTAPTAV
RMFMRMGEEWPGKYNLSSLRILGSVGEPLNPEAFKWYYRVIGKEKCPVLDTWWQTETGMH
MLTTAVGEPMKPGFTGRPVPGVVVDVVDENGDPVPAGTGGFLVIKQPWPSMMRTVYGNDE
RYRQYWTTIKNYYSAGDLAVKDEDGYIMIQGRADDVLIVAGHNIGSAEVESALVSHEAVA
EAAVIGKPDPLKGDSIKAFVILRMGFNSSDKLKLDLLYHVRMNLGPIAMPSEIEFVDSLP
KTRSGKIMRRLLKAQELGMDPGDVSSLED
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaaaatttgacgttaagctggatagtaaaagctattttcctgatccatcggta
aaggaaaattcctggatgcaggattatgaaaaggtttatagtgaatctctcaaggatcct
gaaaaacactgggaaaatgttgcagaggaacttgaatggttcgaaaagtgggacaaggtg
atggaatgggaccatccctatgcaaaatggttcaccaatgccaaaatgaacatcacccac
aactgccttgaccgccatgtcttcaatgggagaaggaacaaagttgcaatgatctgggta
ggtgataatggagaagaacaggttatcacatatcgtcagctttaccgcgatgtcatgaga
ttttccaatggtctcaaatctttgggcgttgggaaaggtgacacggtatgcatatacatg
ccacaggtccctgagcagatcgtggccatgctggcatgtgcacgtatcggtgcgatccat
agtgtcgtgttcggaggctttggtgctaaagcattgcattccaggataaaggatgcacag
gcaaaagtcgtcattactgcagatgcaagcattcggcgtggtaagcgcattgacctgaag
tcccttgtggatgaagctgtggttaatgcgtcatgcgttgagaagatagtggtcctgaga
agaatgacacctcaaattgaactcttttctgagatagaggttgacttctatgagataatg
gaagatgtggagaaagagtgtgagcctgaaataatggattccgaggacccattgttcatt
ctctacaccagcggaacaaccggtccggccaaggggatagttcatacttgcggtggctac
atggtaggcacatactacaccacaaagaacgttttagacctcaaggataatgatgtcctg
tggtgtactgcagaccctggctggatcacgggtcacagctacattgtctatggtcccctt
tccatgggtgcaacgatcctcatttctgagacaacacctgactaccctgatccgggagtc
tggtggagcatgatagaggagtttgatgtgagcgtcttctatacggcaccaacagcggta
cgcatgttcatgaggatgggagaggaatggcctgggaaatacaatctgagttccctgaga
atactaggttctgttggcgaaccactgaacccagaagcgttcaagtggtattatcgtgtg
atcggcaaagaaaaatgccctgttctggatacctggtggcagacggagacgggtatgcac
atgctcaccacagcggttggagagcccatgaaaccgggattcacaggaagacctgtacca
ggtgtggttgttgatgttgtagatgagaatggtgacccggtgcctgcaggaacaggtggt
ttccttgtaataaagcaaccctggccttccatgatgaggaccgtttatggtaatgatgaa
agatatcgccagtattggacaactatcaagaattactacagtgcaggtgatcttgccgta
aaggatgaggatggttatatcatgatacagggacgtgccgacgatgtccttatcgttgcc
ggtcacaatattggaagtgcagaggtagagagtgcacttgtatcccatgaagctgtggct
gaagctgctgtaataggaaaacctgatcctcttaaaggggattccatcaaagctttcgtc
atacttcgcatgggcttcaactcatccgataaactgaagcttgatcttttgtatcatgta
aggatgaacctgggtccaattgcaatgccttctgagatcgaatttgttgactcgctgcca
aaaacccgaagcgggaagatcatgagaaggttgcttaaggcacaggagcttggaatggat
cctggggatgtgtcctcattggaggactga

DBGET integrated database retrieval system