KEGG   Methanococcoides burtonii: Mbur_1433Help
Entry
Mbur_1433         CDS       T00341                                 

Definition
protoporphyrin IX magnesium-chelatase (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
mbu  Methanococcoides burtonii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mbu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mbur_1433
Enzymes [BR:mbu01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Mbur_1433
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1512615..1513628
Genome map
AA seq 337 aa AA seqDB search
MYPISGIVGQEMMLRALILNAINPSIGGVLVRGQKGTAKSTAVRGLAEILPDIEVIDGCQ
YNCDPLDPNTFCWECVDKQRKGQIKVEKIPMKVVDLPVGATEDRVVGSLDIEKAVKEGTQ
AFEPGILANANRNILYVDEINLLDDFVVDALLDAAAMNVNTVEREGISVSHPANFIIVGS
MNPEEGELRPQLLDRIALQVEVEGITDIEQRVEIIERRNKFNDDPQGFRRDFESEQDKLR
TKIIKAKQAIARISATRDNLRTIAKICVAFNVDGHRADIMIERTARTNAAYEGRERITNE
DIIEAAEMVLPHRMRKKPFEEEEFSAEQLRAVVNGTV
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgtacccaatttcgggaattgtgggacaggaaatgatgcttcgggcattgatactgaat
gccattaatccatccatcggaggagttctggtacgaggtcagaaaggaacggcaaaatca
accgcagtgagaggattagcagagatcttgccggatattgaagtaatagatggatgccaa
tacaactgtgacccgcttgacccaaacactttctgctgggaatgtgtggacaaacagaga
aagggccagataaaggtagaaaaaataccgatgaaagttgtagaccttccagtaggagct
actgaggacagagttgttggaagtctcgatattgagaaagctgtaaaggaaggtacacag
gcatttgaaccgggtattcttgccaatgcaaatagaaatatcctttatgtggatgagatc
aaccttctggatgattttgtagtggatgcattgcttgatgctgctgcaatgaacgtaaat
acggtggaaagagaaggtataagtgtcagccaccctgccaatttcattatcgtaggtagc
atgaacccggaggaaggagaacttcgaccacagcttcttgacagaatagcccttcaggtc
gaagtagagggaattaccgatattgagcaaagggtagagatcattgaaagaaggaacaaa
ttcaatgatgacccacaaggattcagaagggattttgaatctgaacaggataagttgcgt
accaagataatcaaagcaaaacaggctatcgccagaatatccgcaacaagagataatctg
cgaacaattgcgaaaatatgtgtcgctttcaatgttgatggtcatagagccgatattatg
atagagcgtactgcacgcacaaatgcagcctatgaaggcagagaaaggatcaccaacgag
gatatcatagaggccgcagagatggtactgcctcatagaatgagaaagaaaccattcgag
gaagaggagttcagtgcggaacaacttcgggctgtagttaacggaactgtataa

DBGET integrated database retrieval system