KEGG   Methanococcoides burtonii: Mbur_1433Help
Entry
Mbur_1433         CDS       T00341                                 

Gene name
bchI
Definition
(GenBank) protoporphyrin IX magnesium-chelatase
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
mbu  Methanococcoides burtonii
Pathway
mbu00860  Porphyrin and chlorophyll metabolism
mbu01100  Metabolic pathways
mbu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mbu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mbur_1433 (bchI)
Enzymes [BR:mbu01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Mbur_1433 (bchI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 AAA_3 MCM Sigma54_activat AAA_16
Motif
Other DBs
NCBI-ProteinID: ABE52344
JGI: Mbur1433
UniProt: Q12W32
Position
1512615..1513628
Genome map
AA seq 337 aa AA seqDB search
MYPISGIVGQEMMLRALILNAINPSIGGVLVRGQKGTAKSTAVRGLAEILPDIEVIDGCQ
YNCDPLDPNTFCWECVDKQRKGQIKVEKIPMKVVDLPVGATEDRVVGSLDIEKAVKEGTQ
AFEPGILANANRNILYVDEINLLDDFVVDALLDAAAMNVNTVEREGISVSHPANFIIVGS
MNPEEGELRPQLLDRIALQVEVEGITDIEQRVEIIERRNKFNDDPQGFRRDFESEQDKLR
TKIIKAKQAIARISATRDNLRTIAKICVAFNVDGHRADIMIERTARTNAAYEGRERITNE
DIIEAAEMVLPHRMRKKPFEEEEFSAEQLRAVVNGTV
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgtacccaatttcgggaattgtgggacaggaaatgatgcttcgggcattgatactgaat
gccattaatccatccatcggaggagttctggtacgaggtcagaaaggaacggcaaaatca
accgcagtgagaggattagcagagatcttgccggatattgaagtaatagatggatgccaa
tacaactgtgacccgcttgacccaaacactttctgctgggaatgtgtggacaaacagaga
aagggccagataaaggtagaaaaaataccgatgaaagttgtagaccttccagtaggagct
actgaggacagagttgttggaagtctcgatattgagaaagctgtaaaggaaggtacacag
gcatttgaaccgggtattcttgccaatgcaaatagaaatatcctttatgtggatgagatc
aaccttctggatgattttgtagtggatgcattgcttgatgctgctgcaatgaacgtaaat
acggtggaaagagaaggtataagtgtcagccaccctgccaatttcattatcgtaggtagc
atgaacccggaggaaggagaacttcgaccacagcttcttgacagaatagcccttcaggtc
gaagtagagggaattaccgatattgagcaaagggtagagatcattgaaagaaggaacaaa
ttcaatgatgacccacaaggattcagaagggattttgaatctgaacaggataagttgcgt
accaagataatcaaagcaaaacaggctatcgccagaatatccgcaacaagagataatctg
cgaacaattgcgaaaatatgtgtcgctttcaatgttgatggtcatagagccgatattatg
atagagcgtactgcacgcacaaatgcagcctatgaaggcagagaaaggatcaccaacgag
gatatcatagaggccgcagagatggtactgcctcatagaatgagaaagaaaccattcgag
gaagaggagttcagtgcggaacaacttcgggctgtagttaacggaactgtataa

DBGET integrated database retrieval system