KEGG   Methanococcoides burtonii: Mbur_1516Help
Entry
Mbur_1516         CDS       T00341                                 

Definition
CoB--CoM heterodisulfide reductase subunit C (EC:1.8.98.1)
Orthology
K03390  
heterodisulfide reductase subunit C [EC:1.8.98.1]
Organism
mbu  Methanococcoides burtonii
Pathway
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Methanogenesis, methanol => methane
Methanogenesis, acetate => methane
Methanogenesis, methylamine/dimethylamine/trimethylamine => methane
Methanogenesis, CO2 => methane
Methanogen
Brite
KEGG Orthology (KO) [BR:mbu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mbur_1516
  Energy metabolism
   00680 Methane metabolism
    Mbur_1516
Enzymes [BR:mbu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.98  With other, known, acceptors
    1.8.98.1  CoB---CoM heterodisulfide reductase
     Mbur_1516
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1593881..1594375
Genome map
AA seq 164 aa AA seqDB search
MSATNGSTFLSRLDKTGTDILKCMHCGVCTGSCPSGRHTSLNVRNLLRKARKGESVLSDE
TLWTCTTCYNCQERCPRGIDIVDAIFEIRAIAVHEGIILPEHRTVGKLLIEHGHAVPINA
ENRTKRISLGMDEMPPTVHSYPDALNEVKKLLADCKFDELMLNE
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctacaaatggatcaacttttctatccaggctggataaaacgggaactgacatt
ctcaaatgcatgcattgtggcgtttgtaccggcagttgtccgtctggaaggcatacgagc
ctgaatgtaaggaatttgctcaggaaagctcgcaaaggtgaatctgtgctttctgatgag
acactttggacatgtacaacatgttataattgccaggaacgttgcccgaggggaattgat
attgttgatgctatttttgagatacgtgcaatagcagtacatgaagggatcatcctcccg
gaacatcgcaccgtgggtaaactgttaatcgaacatgggcatgcagtccccataaatgct
gagaacagaacaaagagaatatcacttgggatggatgaaatgccacccacagtacatagt
tatccggatgctttgaatgaagttaagaagttgcttgctgactgtaaattcgatgagttg
atgctaaatgagtga

DBGET integrated database retrieval system