KEGG   Methanococcoides burtonii: Mbur_1580Help
Entry
Mbur_1580         CDS       T00341                                 

Definition
asparagine synthase, glutamine-hydrolyzing
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mbu  Methanococcoides burtonii
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mbu00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Mbur_1580
Enzymes [BR:mbu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Mbur_1580
Peptidases [BR:mbu01002]
 Cysteine Peptidases
  Family C44
   Mbur_1580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1658460..1660364
Genome map
AA seq 634 aa AA seqDB search
MCGICGYAGFDDEDLLGKMCDAIVHRGPDDSGSFTDKGIGLGHRRLSIIDLEGGHQPVCN
EDGTIYVVYNGEIYNFLSLRDELEKRGHRFQTSSDTEVIVHLYEEYGKDLVHHLRGMFAF
ALWDSNTRTLLLARDRLGVKPLYYTTIDNRLLFASEIKSIVQYSGYEKAVDIGTLHDYLT
FRHALGTETMFAGIKKLLPGHVMTYREGEVNISEYWDVPLVTVGNESEDFYIKKTRLLLE
ESVKMRLMSEVPLGIYLSGGIDSGIVTGLMSKMVDEPIETFSVGFGERGEIGELSQAQEA
ADFFGTNHHEIIVDQGAFKQNLKDIIWHNDEPIADPSALAMFQLSKMASKHVTVVLNGAG
GDEVFGGYISYKVGLANQKYHKIVPKVIRQGLVRPFVNAISPHLSSKMYVGIQSATQEVE
EHGFLFTKSVFSEEDKEDIYTDKIKDKIHHNTFEKATTSLFRGKRYSGAIDERSSAKNTD
LLSKMMYADTKSYLVDHILLETDKLTMSSSIEARVPIIDHKVVEFAASIPQELKLRGMTE
KYILKKVGQGMLPPAAQNRKKRPFRIPIDTWFKDELHEMSQQVLDESSIVEQGYFRPEVV
KDIMKKHERAELLYNHQMYALLVFEMWHERFMKM
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
ttgtgtggaatatgcggatatgcaggctttgatgatgaagacctccttggaaaaatgtgt
gatgctatcgttcatcgtggtcctgatgatagtggctcatttacggataaggggattggt
cttggacatcgccgattgagcatcattgatcttgaaggcggacatcaaccggtatgcaat
gaagatggaactatctatgttgtatataacggggagatctataattttctgagcttaagg
gatgagcttgaaaaacgaggtcatcgttttcagacatcatcagataccgaggtaattgtt
cacctttatgaagaatatgggaaggaccttgtccatcatcttcgaggtatgttcgctttt
gcattgtgggattcaaacaccaggacactattgcttgcccgcgaccgacttggggtcaag
ccactctattacaccaccatagacaacagattgttatttgcatccgaaataaagtcgata
gttcagtatagcggttatgaaaaagccgttgatataggaaccttacacgattatttgaca
ttccgccatgctcttggaaccgaaacgatgtttgccggaattaagaaattgttgccggga
catgtaatgacatatcgggaaggtgaagtaaatatttcagagtactgggatgtaccacta
gtaactgttggaaatgaaagtgaggacttttacattaaaaagacacgtcttttgctggaa
gagtctgttaaaatgcgacttatgagcgaagtgccccttggaatttatctttccggcggg
atagattcgggaatagttaccggactaatgagcaagatggttgatgaacctattgaaaca
ttctctgttgggttcggggagcggggagagataggtgagttgagccaggctcaggaagct
gcagacttttttggaacgaaccatcatgagataatagtagatcagggtgctttcaaacaa
aacctcaaagatatcatatggcataacgatgagccaatagcagacccttctgcactggca
atgttccagctttcgaaaatggcaagcaaacatgtgaccgttgtgctcaacggagccggc
ggggatgaggtatttggaggctatatcagctataaagtgggtcttgcgaaccaaaaatac
cataagatagttccaaaggtcattagacagggactcgttaggccttttgtgaatgcgatc
tctccccacctttcgagcaagatgtacgttgggatacaaagtgccactcaggaagtggaa
gagcatggatttctttttacgaaatctgtgttcagtgaagaagataaggaagatatctac
acagataagataaaagataaaattcaccacaatacattcgagaaggcaactacaagttta
ttcagaggaaagaggtattcaggagcaatagatgagcggagcagtgctaaaaatacagac
cttctttcaaagatgatgtatgcggatacaaagtcatatcttgttgatcatatactgctt
gaaacggataagcttaccatgtcaagctccattgaagcgagagttcctatcatagaccat
aaggtcgttgaatttgcagccagtattcctcaggaattgaaacttcgtggtatgactgag
aaatatatattgaagaaagttggtcaaggcatgttaccacctgctgcacagaaccggaag
aaacgaccattccggatacctatcgatacgtggttcaaagacgagcttcacgaaatgtca
cagcaggtgcttgatgagtcatcaatcgtggaacagggatatttcagaccggaagttgtc
aaggacatcatgaaaaaacatgaaagagcagaattgttgtataatcatcagatgtatgct
ttgctggtgttcgagatgtggcatgaaagatttatgaagatgtga

DBGET integrated database retrieval system