KEGG   Methanococcoides burtonii: Mbur_1612Help
Entry
Mbur_1612         CDS       T00341                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mbu  Methanococcoides burtonii
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:mbu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Mbur_1612
   00052 Galactose metabolism
    Mbur_1612
   00500 Starch and sucrose metabolism
    Mbur_1612
   00520 Amino sugar and nucleotide sugar metabolism
    Mbur_1612
Enzymes [BR:mbu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Mbur_1612
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1691806..1692678)
Genome map
AA seq 290 aa AA seqDB search
MDVKKAVIPAAGLGTRFLPATKSMPKEMLPIIDKPVIHYVVEEAIASGIDDIIFVTGRSK
RAIEDYFDESPELQMHLKEHHKDSLLKMVEDISSMVDIHYIRQKEPRGLGDAIMTAKKHI
SGDPFAVLLGDDIIVNDVPCTKQLIEVFQKYRCSTIAVEEVPREKVSSYGIISGKPIDDS
LCILEDIIEKPSVEEAPSNIGAIGRYVFTPEIFDCINKTSTGVGGEIQLTDGIRLLNEQQ
KVYAYRFAGQRYDTGDKLGYVKAIVDFALKNEEMAPSIREHIKNVLGSGF
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggatgttaaaaaagcagtaatcccggcggctggtcttgggactcgatttttaccagca
actaaatcgatgcctaaagagatgcttccaataatagataaaccggttatccattatgtt
gttgaggaagcgatcgcatcagggatcgatgacatcatttttgtgaccggacgcagtaaa
agggctattgaggattactttgatgaatccccagagcttcagatgcacctgaaggagcat
cataaagattcccttcttaaaatggtggaggacatttcttcaatggtggatatccattac
atcagacagaaggaaccgcgtggcttgggtgatgctattatgactgcaaagaagcacata
agtggtgatccgttcgctgtgcttctcggtgatgatattattgtgaatgatgtgccgtgt
acgaaacagcttatcgaggttttccagaaataccgatgttcaactattgctgttgaggaa
gttccccgtgaaaaagtaagcagttacggtattataagtggcaaaccaattgatgattca
ctttgtatccttgaagatatcattgagaaaccatctgttgaagaagcgccatctaacatc
ggagctatcggcaggtatgttttcactccggaaatatttgattgtatcaacaaaacttcc
acaggcgttggtggtgagattcagctcactgatggcatcagacttcttaatgagcagcag
aaggtctatgcttatagatttgcagggcaaagatatgatactggggataaactgggctat
gtgaaggctattgttgattttgcgttgaagaatgaggagatggctcccagtataagagaa
cacattaaaaatgtattaggatcgggattctaa

DBGET integrated database retrieval system