KEGG   Methanococcoides burtonii: Mbur_1894Help
Entry
Mbur_1894         CDS       T00341                                 

Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mbu  Methanococcoides burtonii
Brite
Enzymes [BR:mbu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Mbur_1894
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_25 Methyltransf_3 RrnaAD GCD14 Methyltransf_11 Methyltr_RsmB-F Ubie_methyltran Fibrillarin MTS Methyltransf_24 Methyltransf_23 CMAS Methyltransf_4 Methyltransf_32 Methyltransf_16 POTRA Methyltransf_12 UPF0020
Motif
Other DBs
NCBI-ProteinID: ABE52776
JGI: Mbur1894
UniProt: Q12UV0
Position
complement(1988298..1988909)
Genome map
AA seq 203 aa AA seqDB search
MIRALKANGTDQRVLNAMKKVPRHLFLPEDMQSFAYADTPLPIGYDQTISAPHMVAIMCD
LLKITEGMTILEIGSGSGYNAAVMAELAGENGKVYTVERIPELVDLARNNLERAGYSNVT
VVHDDGSCGLPEHAPYDRIAVTSVAPEVPPPLREQLSKNGIMVIPVGTQYQTLVVVKKDS
KGNITHKAMGEVIFVPLIGKYGF
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
ttgataagagcactgaaagctaacgggaccgatcagcgagtgctcaatgctatgaaaaag
gtcccgagacatctttttttacctgaggatatgcaaagttttgcttatgcagacactcca
ttacccatcggatatgatcaaacgatctccgcaccccatatggtcgccataatgtgcgat
ctcctgaaaattactgagggaatgactattctggagatcggtagcggttcaggatataat
gctgctgtaatggctgagcttgcaggtgagaatgggaaagtctacacggtcgaacgcatt
ccagaacttgtggaccttgccaggaacaaccttgaaagagcaggatattcaaatgtcact
gtggtacatgatgacggatcctgcggtctgcctgaacatgccccatacgaccgcatcgct
gtgacttcagtggcacctgaggtcccaccaccacttagagaacaattgtcaaagaacggt
ataatggtgatcccggtaggaacacaatatcaaacccttgtcgtcgtaaagaaagacagc
aaaggcaacatcacccataaagcgatgggagaagtgatatttgtcccccttatagggaaa
tacggtttttga

DBGET integrated database retrieval system