KEGG   Methanococcoides burtonii: Mbur_1989Help
Entry
Mbur_1989         CDS       T00341                                 

Definition
(GenBank) Elongator complex protein 3
  KO
K07739  elongator complex protein 3 [EC:2.3.1.48]
Organism
mbu  Methanococcoides burtonii
Brite
Enzymes [BR:mbu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Mbur_1989
Transfer RNA biogenesis [BR:mbu03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Mbur_1989
Chromosome [BR:mbu03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    Mbur_1989
   HAT complexes
    Elongator complex
     Mbur_1989
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM_C Radical_SAM Acetyltransf_10 Acetyltransf_1 Acetyltransf_7
Motif
Other DBs
NCBI-ProteinID: ABE52868
JGI: Mbur1989
UniProt: Q12UK8
Position
2090646..2092292
Genome map
AA seq 548 aa AA seqDB search
MTSEVNDNFRVACRKLLDMVLDGEISDEKQLTKAKKVISKEYRLSTLPKHPDIIMVGTDE
EQKLVRDLLRRKPVRTISGVAVIAAMTSPCECPHGVCIPCPGGPKSSFNSPQSYMGQEPA
TMRAMQYEYDPYRIVSGRLSQLKHIGHDVDKAELIVMGGTFSSRAIDYQEWYTKRCLEAM
NDFSGTQWREDIKVIGDVVPYVTVEDVQRANETAIVRNTGITFETRPDWTNTDHVDRMLD
LGATKVEIGVQSVYDFVLERMRRGHSVQDSVDSNRVLRDSALKVGFHMMPHLPGMDSARD
LRGFKKLFSDSNFMPDYLKIYPTLVTEGTELYDMWSGGEYEALGDEEAIELLADIKAILP
KWVRMQRIQRDIPSPQIFAGVKKSNVRQLAKERLESRGVKCKCIRCREVGHNVLKGNEPD
VDSIELTIDTYDSCGGKEHFLSFEDVSTDILIGFLRLRFPNTPHREELQDAALVRELHVY
GSMVPVGKGAVGMDWQHRGYGAELLENAEILAKDAGYLKVSIISGIGVRQYYRKFGYYRD
GVYMSKMI
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgacatcggaagttaatgataatttcagggttgcatgccgaaagttgctggatatggtg
cttgatggtgagatctctgacgagaagcaattgaccaaggcgaaaaaggttatcagcaaa
gagtacaggctatccactctccctaaacatcctgatattattatggtgggtacagatgag
gagcagaagctcgttcgtgatcttcttcgccgaaagcctgttcggactatctctggagtg
gcggtaatagcggcaatgacatctccctgtgagtgtcctcacggggtatgtattccttgt
cctggaggcccgaagtcctctttcaattctcctcaaagctatatgggtcaggaacctgct
acaatgagggcgatgcaatatgagtatgatccttatcgcattgtctctggtcgtctttcc
cagttaaagcatataggccatgatgtggacaaggcagagcttattgtcatgggtggtacg
ttctcctcacgtgctattgattatcaggaatggtacactaagagatgccttgaggccatg
aacgatttttccggtacacagtggcgtgaagacataaaagttatcggagatgtcgttcct
tatgtgacggtcgaagatgtccagagggcgaatgagaccgctattgtccgtaatacgggc
ataacctttgaaacaagaccggattggacaaatactgatcatgtggaccggatgcttgat
ctgggtgctaccaaggtcgagatcggtgtgcaaagtgtatatgatttcgtgcttgaaaga
atgcggaggggtcatagtgttcaggattcggtagattcgaaccgggtgctacgggatagt
gcactgaaggtgggtttccatatgatgccacatcttccgggaatggattctgcaagggac
cttaggggattcaaaaagctgttctctgatagtaatttcatgccggattatctcaagatc
tatcctacactggtgacggaaggtactgaactatatgatatgtggtcgggaggggaatat
gaggctctcggtgatgaggaggctatcgagcttctggccgacatcaaggcaattctgcct
aagtgggtccgtatgcagcgtatccagagggatattccgtcccctcagatattcgcaggc
gtgaagaaaagcaatgtaagacagcttgcgaaggaacgtctcgagtcaaggggtgttaag
tgtaagtgtatacgttgcagggaagtcggtcataatgtcctcaaagggaatgaacctgat
gtcgatagtatagagcttaccatcgatacatacgattcttgtggcggaaaggaacatttc
ctttcgttcgaggatgtcagtactgatatccttataggcttcttacgtcttcggttcccg
aatacacctcacagggaagaattgcaggatgctgcattggtgagggaacttcatgtgtac
ggttctatggttccggtgggcaaaggtgctgtgggtatggactggcagcataggggctat
ggtgctgaattattagagaatgcagaaattctggcaaaagatgcagggtatttaaaagtt
tctatcattagtggtattggtgtaagacagtattatcgcaagtttggatattatcgagat
ggtgtatatatgtcaaaaatgatatga

DBGET integrated database retrieval system