KEGG   Methanococcoides burtonii: Mbur_1989Help
Entry
Mbur_1989         CDS       T00341                                 

Definition
ELP3 family histone acetyltransferase
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
mbu  Methanococcoides burtonii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2090646..2092292
Genome map
AA seq 548 aa AA seqDB search
MTSEVNDNFRVACRKLLDMVLDGEISDEKQLTKAKKVISKEYRLSTLPKHPDIIMVGTDE
EQKLVRDLLRRKPVRTISGVAVIAAMTSPCECPHGVCIPCPGGPKSSFNSPQSYMGQEPA
TMRAMQYEYDPYRIVSGRLSQLKHIGHDVDKAELIVMGGTFSSRAIDYQEWYTKRCLEAM
NDFSGTQWREDIKVIGDVVPYVTVEDVQRANETAIVRNTGITFETRPDWTNTDHVDRMLD
LGATKVEIGVQSVYDFVLERMRRGHSVQDSVDSNRVLRDSALKVGFHMMPHLPGMDSARD
LRGFKKLFSDSNFMPDYLKIYPTLVTEGTELYDMWSGGEYEALGDEEAIELLADIKAILP
KWVRMQRIQRDIPSPQIFAGVKKSNVRQLAKERLESRGVKCKCIRCREVGHNVLKGNEPD
VDSIELTIDTYDSCGGKEHFLSFEDVSTDILIGFLRLRFPNTPHREELQDAALVRELHVY
GSMVPVGKGAVGMDWQHRGYGAELLENAEILAKDAGYLKVSIISGIGVRQYYRKFGYYRD
GVYMSKMI
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgacatcggaagttaatgataatttcagggttgcatgccgaaagttgctggatatggtg
cttgatggtgagatctctgacgagaagcaattgaccaaggcgaaaaaggttatcagcaaa
gagtacaggctatccactctccctaaacatcctgatattattatggtgggtacagatgag
gagcagaagctcgttcgtgatcttcttcgccgaaagcctgttcggactatctctggagtg
gcggtaatagcggcaatgacatctccctgtgagtgtcctcacggggtatgtattccttgt
cctggaggcccgaagtcctctttcaattctcctcaaagctatatgggtcaggaacctgct
acaatgagggcgatgcaatatgagtatgatccttatcgcattgtctctggtcgtctttcc
cagttaaagcatataggccatgatgtggacaaggcagagcttattgtcatgggtggtacg
ttctcctcacgtgctattgattatcaggaatggtacactaagagatgccttgaggccatg
aacgatttttccggtacacagtggcgtgaagacataaaagttatcggagatgtcgttcct
tatgtgacggtcgaagatgtccagagggcgaatgagaccgctattgtccgtaatacgggc
ataacctttgaaacaagaccggattggacaaatactgatcatgtggaccggatgcttgat
ctgggtgctaccaaggtcgagatcggtgtgcaaagtgtatatgatttcgtgcttgaaaga
atgcggaggggtcatagtgttcaggattcggtagattcgaaccgggtgctacgggatagt
gcactgaaggtgggtttccatatgatgccacatcttccgggaatggattctgcaagggac
cttaggggattcaaaaagctgttctctgatagtaatttcatgccggattatctcaagatc
tatcctacactggtgacggaaggtactgaactatatgatatgtggtcgggaggggaatat
gaggctctcggtgatgaggaggctatcgagcttctggccgacatcaaggcaattctgcct
aagtgggtccgtatgcagcgtatccagagggatattccgtcccctcagatattcgcaggc
gtgaagaaaagcaatgtaagacagcttgcgaaggaacgtctcgagtcaaggggtgttaag
tgtaagtgtatacgttgcagggaagtcggtcataatgtcctcaaagggaatgaacctgat
gtcgatagtatagagcttaccatcgatacatacgattcttgtggcggaaaggaacatttc
ctttcgttcgaggatgtcagtactgatatccttataggcttcttacgtcttcggttcccg
aatacacctcacagggaagaattgcaggatgctgcattggtgagggaacttcatgtgtac
ggttctatggttccggtgggcaaaggtgctgtgggtatggactggcagcataggggctat
ggtgctgaattattagagaatgcagaaattctggcaaaagatgcagggtatttaaaagtt
tctatcattagtggtattggtgtaagacagtattatcgcaagtttggatattatcgagat
ggtgtatatatgtcaaaaatgatatga

DBGET integrated database retrieval system