KEGG   Methanococcoides burtonii: Mbur_2156Help
Entry
Mbur_2156         CDS       T00341                                 

Definition
(GenBank) Pyruvate synthase delta chain
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
mbu  Methanococcoides burtonii
Pathway
mbu00010  Glycolysis / Gluconeogenesis
mbu00020  Citrate cycle (TCA cycle)
mbu00620  Pyruvate metabolism
mbu00640  Propanoate metabolism
mbu00650  Butanoate metabolism
mbu00680  Methane metabolism
mbu00720  Carbon fixation pathways in prokaryotes
mbu01100  Metabolic pathways
mbu01120  Microbial metabolism in diverse environments
mbu01130  Biosynthesis of antibiotics
mbu01200  Carbon metabolism
Module
mbu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mbu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mbur_2156
   00020 Citrate cycle (TCA cycle)
    Mbur_2156
   00620 Pyruvate metabolism
    Mbur_2156
   00640 Propanoate metabolism
    Mbur_2156
   00650 Butanoate metabolism
    Mbur_2156
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mbur_2156
   00680 Methane metabolism
    Mbur_2156
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mbur_2156
Enzymes [BR:mbu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Mbur_2156
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_6 Fer4_21 Fer4_2 Fer4_7 Fer4_9 Fer4_10 Fer4_16 Fer4_17 Fer4_4 Fer4_8 Fer4_13 Fer4_15 Fer4_3 Fer4_22 Fer4_18
Motif
Other DBs
NCBI-ProteinID: ABE53026
JGI: Mbur2156
UniProt: Q12U50
Position
2261660..2261920
Genome map
AA seq 86 aa AA seqDB search
MTITPGGVCEPGSTLVNKTGGWRTFRPVFDYDKCIKCKLCELLCPDMSVDARDDGFFEFN
YDFCKGCGICANECPTDAIEMVLEEK
NT seq 261 nt NT seq  +upstreamnt  +downstreamnt
atgacaattacaccaggcggcgtttgtgaaccaggatccactcttgtcaacaaaaccggt
ggctggagaacattcagaccagttttcgattatgacaaatgcatcaaatgcaaactctgt
gagctcctttgtccggacatgtcagtcgatgcaagagatgacggtttctttgagttcaac
tacgatttctgcaaaggatgcggtatttgtgcgaacgaatgtccaacggacgctattgag
atggttctggaggagaaataa

DBGET integrated database retrieval system