KEGG   Methanococcoides burtonii: Mbur_2158Help
Entry
Mbur_2158         CDS       T00341                                 

Definition
pyruvate ferredoxin oxidoreductase, beta subunit (EC:1.2.7.1)
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
mbu  Methanococcoides burtonii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mbu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mbur_2158
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mbur_2158
   00020 Citrate cycle (TCA cycle)
    Mbur_2158
   00620 Pyruvate metabolism
    Mbur_2158
   00640 Propanoate metabolism
    Mbur_2158
   00650 Butanoate metabolism
    Mbur_2158
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mbur_2158
   00680 Methane metabolism
    Mbur_2158
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mbur_2158
Enzymes [BR:mbu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Mbur_2158
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2263132..2264007
Genome map
AA seq 291 aa AA seqDB search
MKSLLESGHRGCAGCCDAIAAKFTLMAAGEDCIVVSPTGCLEVMTTPYPESSWNVPFIHS
LFENNAAVASGIEAALKAKGELGKTKIIAMGGDGATLDIGIRSISGAFERGHDFTYVCID
NEAYMNTGVQRSGATPFAASTTTSPAGKVSFGNIRPKKNMPAIMVAHGSPYVTTTSIGYP
KDMIRKVKKAVDVEGPTYVHAHSPCTTGWGFDTSKTIEIAKLAVETCLWPLYEMEDGELT
KAKKIKNPKPVEDYLKMQRRFKHLFTKEGGDEMIKKIQALADANIEKFGLQ
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcactcttagaatctggacataggggatgcgcaggttgctgtgacgcaatagct
gcaaagttcactctcatggcagcaggtgaggactgtatcgttgtaagtcctaccggatgt
cttgaggtcatgaccactccatatcctgaatcttcatggaatgtcccatttatacactcc
ctctttgagaacaatgcagcagtcgcttcaggcattgaggcagctctcaaagcgaagggc
gagttaggcaagaccaagatcattgcaatgggtggtgatggtgcaacccttgatatcggt
atacgttccatatccggtgcattcgagcgtggacatgacttcacatatgtctgtatcgac
aatgaagcatacatgaacaccggtgtacagagaagtggtgcaacaccatttgcagcttcg
accacaaccagtcctgcaggtaaggtgtcctttggtaacattcgtccaaagaagaacatg
ccagccatcatggtagcacatggttctccatacgttacaacaacatccatcggatatcca
aaggatatgataaggaaggtcaagaaagctgtcgatgtcgaaggtcctacctatgtgcat
gcacattcaccatgtactaccggatggggattcgacacctccaagaccatagagatcgca
aagctggcagtcgaaacatgtctctggccactctatgaaatggaagatggtgagctcacc
aaggctaagaagatcaagaaccctaaaccagtcgaggattatcttaagatgcagcgccgt
ttcaaacaccttttcacaaaggaaggtggagacgagatgatcaagaagatacaggcactc
gctgacgctaatattgagaagttcgggttacagtaa

DBGET integrated database retrieval system