KEGG   Methanococcoides burtonii: Mbur_2158Help
Entry
Mbur_2158         CDS       T00341                                 

Definition
(GenBank) Pyruvate synthase beta chain
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
mbu  Methanococcoides burtonii
Pathway
mbu00010  Glycolysis / Gluconeogenesis
mbu00020  Citrate cycle (TCA cycle)
mbu00620  Pyruvate metabolism
mbu00640  Propanoate metabolism
mbu00650  Butanoate metabolism
mbu00680  Methane metabolism
mbu00720  Carbon fixation pathways in prokaryotes
mbu01100  Metabolic pathways
mbu01120  Microbial metabolism in diverse environments
mbu01130  Biosynthesis of antibiotics
mbu01200  Carbon metabolism
Module
mbu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mbu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mbur_2158
   00020 Citrate cycle (TCA cycle)
    Mbur_2158
   00620 Pyruvate metabolism
    Mbur_2158
   00640 Propanoate metabolism
    Mbur_2158
   00650 Butanoate metabolism
    Mbur_2158
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mbur_2158
   00680 Methane metabolism
    Mbur_2158
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mbur_2158
Enzymes [BR:mbu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Mbur_2158
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: ABE53028
JGI: Mbur2158
UniProt: Q12U48
Position
2263132..2264007
Genome map
AA seq 291 aa AA seqDB search
MKSLLESGHRGCAGCCDAIAAKFTLMAAGEDCIVVSPTGCLEVMTTPYPESSWNVPFIHS
LFENNAAVASGIEAALKAKGELGKTKIIAMGGDGATLDIGIRSISGAFERGHDFTYVCID
NEAYMNTGVQRSGATPFAASTTTSPAGKVSFGNIRPKKNMPAIMVAHGSPYVTTTSIGYP
KDMIRKVKKAVDVEGPTYVHAHSPCTTGWGFDTSKTIEIAKLAVETCLWPLYEMEDGELT
KAKKIKNPKPVEDYLKMQRRFKHLFTKEGGDEMIKKIQALADANIEKFGLQ
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcactcttagaatctggacataggggatgcgcaggttgctgtgacgcaatagct
gcaaagttcactctcatggcagcaggtgaggactgtatcgttgtaagtcctaccggatgt
cttgaggtcatgaccactccatatcctgaatcttcatggaatgtcccatttatacactcc
ctctttgagaacaatgcagcagtcgcttcaggcattgaggcagctctcaaagcgaagggc
gagttaggcaagaccaagatcattgcaatgggtggtgatggtgcaacccttgatatcggt
atacgttccatatccggtgcattcgagcgtggacatgacttcacatatgtctgtatcgac
aatgaagcatacatgaacaccggtgtacagagaagtggtgcaacaccatttgcagcttcg
accacaaccagtcctgcaggtaaggtgtcctttggtaacattcgtccaaagaagaacatg
ccagccatcatggtagcacatggttctccatacgttacaacaacatccatcggatatcca
aaggatatgataaggaaggtcaagaaagctgtcgatgtcgaaggtcctacctatgtgcat
gcacattcaccatgtactaccggatggggattcgacacctccaagaccatagagatcgca
aagctggcagtcgaaacatgtctctggccactctatgaaatggaagatggtgagctcacc
aaggctaagaagatcaagaaccctaaaccagtcgaggattatcttaagatgcagcgccgt
ttcaaacaccttttcacaaaggaaggtggagacgagatgatcaagaagatacaggcactc
gctgacgctaatattgagaagttcgggttacagtaa

DBGET integrated database retrieval system