KEGG   Methanococcoides burtonii: Mbur_2210Help
Entry
Mbur_2210         CDS       T00341                                 

Definition
L-fuculose phosphate aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mbu  Methanococcoides burtonii
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mbu00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2324874..2325425)
Genome map
AA seq 183 aa AA seqDB search
MWQEMAKFGKKLVDHGLVESNFGNISVRVGRSMIITRTGAALDEIEEKSVVEVPIESTSE
LDVLASSEASVHRAIYQGTDAKAIVHAHCPYSVTQTLITDSDRIIPIDSEGKLFLKEIPI
VKGGIGSKEVGEGAVKAFEEHRGMVVYSHGPFTIGKTLPEAYIIMTQIEHSCRIKYLVDL
AKK
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgtggcaagaaatggcaaaattcgggaaaaagcttgtggaccacgggcttgtagagtca
aatttcgggaatattagtgtgcgtgttggaagaagtatgataataacacgaaccggtgcg
gcactggatgagatcgaagagaagagtgtggtagaagtgcccatcgaaagtacatcagaa
cttgacgtactggcatcttcagaggcatcggtccatcgtgcgatctatcagggaacagat
gcaaaagcgattgttcatgcgcattgtccctattccgtcacacagacactcataacggat
tctgacaggataatccctattgacagcgaaggaaagcttttcctgaaagaaatacccatt
gtaaaaggcggtatcggttctaaggaagttggagaaggagctgtaaaggcgtttgaagaa
catagaggaatggtggtctacagccatggtccgttcacaatcgggaagacactcccggaa
gcatatataataatgacacagatcgaacattcatgcagaataaagtatcttgtagatctt
gccaaaaaataa

DBGET integrated database retrieval system