KEGG   Methanococcoides burtonii: Mbur_2283Help
Entry
Mbur_2283         CDS       T00341                                 

Gene name
rps24e
Definition
30S ribosomal protein S24e
Orthology
K02974  
small subunit ribosomal protein S24e
Organism
mbu  Methanococcoides burtonii
Pathway
Ribosome
Module
Ribosome, archaea
Class
Genetic Information Processing; Translation; Ribosome [PATH:mbu03010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2409351..2409659
Genome map
AA seq 102 aa AA seqDB search
MDINIIEDKNNALLNRHEVKFDATFKGSTPSRLDVRGKLAAMLNVPLELVILQKFENTYG
MSAANGYAKIYEDAARMKVVEKEYVLKRNELPEAEVVEEAGE
NT seq 309 nt NT seq  +upstreamnt  +downstreamnt
atggatattaatatcattgaagacaaaaacaatgcgcttctcaacaggcatgaagtgaag
ttcgatgcaacattcaaaggttccacaccttcaaggcttgatgtcaggggcaaactggct
gcaatgcttaacgtacctcttgagcttgtcatccttcagaagttcgagaacacctacgga
atgtctgcagcaaatggatatgcaaagatctacgaagatgcagctcgtatgaaggtcgta
gagaaagaatatgtcctcaagagaaacgaacttcctgaggcagaagttgtagaagaagca
ggtgagtaa

DBGET integrated database retrieval system