KEGG   Mycoplasma bovis PG45: MBOVPG45_0299Help
Entry
MBOVPG45_0299     CDS       T01366                                 

Gene name
tpiA
Definition
triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mbv  Mycoplasma bovis PG45
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mbv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MBOVPG45_0299 (tpiA)
   01230 Biosynthesis of amino acids
    MBOVPG45_0299 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MBOVPG45_0299 (tpiA)
   00051 Fructose and mannose metabolism
    MBOVPG45_0299 (tpiA)
   00562 Inositol phosphate metabolism
    MBOVPG45_0299 (tpiA)
Enzymes [BR:mbv01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MBOVPG45_0299 (tpiA)
Exosome [BR:mbv04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MBOVPG45_0299 (tpiA)
  Exosomal proteins of bladder cancer cells
   MBOVPG45_0299 (tpiA)
  Exosomal proteins of melanoma cells
   MBOVPG45_0299 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
335595..336377
Genome map
AA seq 260 aa AA seqDB search
MKQFIVIGNWKMYKTFTETLNFFDEFAIEYKKFRKANPELVPYIDNNIFGVAPSQCNLPA
YFTNKIPELKLCSQNMSKNEEGAFTGEVSARMLRDINVSYALCGHSERRRYHSNHENDES
THLKIKQSVKYDITPIICIGESKEDRDAGRTEEAIHKQLQILLDEVNIHKVIIAYEPVWS
IGTGITPTPEEVENVSALIHKLTSPDVPVLYGGSISEKNINDFTNLPNLNGFLVGSASLK
IDKFLKLISANSDGIMPKEK
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaatttatagtaattggcaattgaaaaatgtataaaacatttacagaaacatta
aacttttttgatgagtttgctatagaatacaaaaagtttcgcaaagctaatcctgaatta
gttccttacattgataataacatttttggcgtagccccttcacaatgtaatttgcctgcc
tattttacaaataagattcccgaacttaaattatgcagtcaaaatatgtctaaaaatgaa
gaaggcgcttttactggagaagtaagtgcaagaatgcttagagatatcaatgtttcatat
gctttatgtgggcactcagaaagaagaagataccacagcaaccatgaaaatgatgaatca
actcatttaaaaataaagcagtcagttaaatatgacataacaccaattatctgcattggc
gaatctaaagaagacagagatgctggcagaactgaagaggctattcataaacagttacaa
attcttttagatgaagttaatattcacaaagttattatagcttatgaaccagtatgatca
ataggaactggaataactcctacacctgaagaagttgaaaatgtcagtgcactaattcac
aagctaactagccctgatgtgcctgttttatatggtggcagcattagcgagaaaaatata
aatgattttaccaatttgcctaatttaaatggttttttggttggatcagcaagtttaaaa
attgacaaatttttaaaacttatatcagcaaattccgacggaattatgcctaaagaaaaa
taa

DBGET integrated database retrieval system