KEGG   Mycoplasma bovis PG45: MBOVPG45_0325Help
Entry
MBOVPG45_0325     CDS       T01366                                 

Definition
(GenBank) biotin-binding domain protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mbv  Mycoplasma bovis PG45
Pathway
mbv00010  Glycolysis / Gluconeogenesis
mbv00020  Citrate cycle (TCA cycle)
mbv00620  Pyruvate metabolism
mbv01100  Metabolic pathways
mbv01110  Biosynthesis of secondary metabolites
mbv01120  Microbial metabolism in diverse environments
mbv01130  Biosynthesis of antibiotics
mbv01200  Carbon metabolism
Module
mbv_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mbv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MBOVPG45_0325
   00020 Citrate cycle (TCA cycle)
    MBOVPG45_0325
   00620 Pyruvate metabolism
    MBOVPG45_0325
Enzymes [BR:mbv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MBOVPG45_0325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biotin_lipoyl Biotin_lipoyl_2 GCV_H HlyD_3 HlyD_D23 RnfC_N PTS_EIIA_1 NQRA PASTA DUF2118 PUA
Motif
Other DBs
NCBI-ProteinID: ADR25151
UniProt: E4PZP0
Position
368041..368277
Genome map
AA seq 78 aa AA seqDB search
MFKMQFTDVGEGLHEGTVVDVFVTEGQEVKEGQDLFSVETDKMTTEIPAPVSGKIVKILI
SAGQEIHVGEEIFHIETN
NT seq 237 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaatgcaatttacagacgttggtgaaggtcttcacgaaggaacagttgttgac
gtttttgttactgaaggtcaagaagttaaagaaggtcaagacttattctcagttgaaact
gacaaaatgacaacagaaattcctgctccagtatcaggcaaaattgttaaaattttaatt
tctgctggtcaagaaattcatgttggtgaagaaatttttcacattgaaacaaactaa

DBGET integrated database retrieval system