KEGG   Mycoplasma bovis PG45: MBOVPG45_0325Help
Entry
MBOVPG45_0325     CDS       T01366                                 

Definition
biotin-binding domain-containing protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mbv  Mycoplasma bovis PG45
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mbv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MBOVPG45_0325
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MBOVPG45_0325
   00020 Citrate cycle (TCA cycle)
    MBOVPG45_0325
   00620 Pyruvate metabolism
    MBOVPG45_0325
Enzymes [BR:mbv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MBOVPG45_0325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
368041..368277
Genome map
AA seq 78 aa AA seqDB search
MFKMQFTDVGEGLHEGTVVDVFVTEGQEVKEGQDLFSVETDKMTTEIPAPVSGKIVKILI
SAGQEIHVGEEIFHIETN
NT seq 237 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaatgcaatttacagacgttggtgaaggtcttcacgaaggaacagttgttgac
gtttttgttactgaaggtcaagaagttaaagaaggtcaagacttattctcagttgaaact
gacaaaatgacaacagaaattcctgctccagtatcaggcaaaattgttaaaattttaatt
tctgctggtcaagaaattcatgttggtgaagaaatttttcacattgaaacaaactaa

DBGET integrated database retrieval system