KEGG   Mycoplasma bovis PG45: MBOVPG45_0358Help
Entry
MBOVPG45_0358     CDS       T01366                                 

Gene name
gtaB
Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mbv  Mycoplasma bovis PG45
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mbv00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MBOVPG45_0358 (gtaB)
   00052 Galactose metabolism
    MBOVPG45_0358 (gtaB)
   00500 Starch and sucrose metabolism
    MBOVPG45_0358 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    MBOVPG45_0358 (gtaB)
Enzymes [BR:mbv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MBOVPG45_0358 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(407105..407992)
Genome map
AA seq 295 aa AA seqDB search
MNKKVRKLIIPAAGWGTRFLPMTKVVHKELLPILDTPLISLLVDEAIEAGIEEIILIISE
RKKDIANYFAVNKELETELESKNKLSLLKKVKSTNKEGLIKIVIQHSQNGLGHALACAKN
VIKDEPFAIILGDDLIKSKVPAIKQLIEFYYKTGSNILGVQSVSDSDIPKYGIVAPIDEN
EKSTNFFKIKGAVEKPKLSEAPSNKAILGRYVFNSEILDILSKIEYDGSNEIQVVDAFEK
LQNEYKQDIYAFVFEGTRYDLGSVKGFVQANIDYALDNIELKDELTEFINEKLSE
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaagttagaaaattaattattccagctgctgggtgaggcactagatttttg
cctatgacaaaagttgtgcacaaagaacttttgcctattttggatacaccattaattagt
ttgcttgttgacgaagctatagaagcaggcatcgaagaaataattcttattattagcgaa
agaaaaaaagatattgcaaactattttgctgttaataaagaattagaaactgaattagaa
tcaaaaaataagttatcactattaaaaaaggtgaaatcaacaaataaggaaggtctgatt
aaaattgttatccagcatagtcaaaatggtttaggacatgccttagcatgtgcaaaaaac
gttattaaagatgagccatttgcaattattttaggagatgatttaataaaatctaaagtt
cctgcaattaaacaattgattgaattttactataaaacaggttcaaacatcttgggagtt
caatcagtaagcgatagcgatatacccaaatatggaattgttgcgcctatagatgaaaat
gaaaagagtacaaactttttcaaaattaaaggtgctgtagaaaaaccaaaattaagtgaa
gcaccaagcaataaagcaatcttaggaagatatgtattcaatagtgaaatattagacata
cttagcaaaattgaatatgatggatctaatgaaattcaagttgttgatgcatttgaaaaa
ttgcaaaatgaatataaacaagatatctatgcatttgtatttgaaggaacaagatatgac
ttaggctcagtcaaaggatttgttcaagctaatattgactatgcattggataatatagag
cttaaggatgaattaacagaatttataaacgaaaagctaagtgaataa

DBGET integrated database retrieval system