KEGG   Mycoplasma bovis PG45: MBOVPG45_0516Help
Entry
MBOVPG45_0516     CDS       T01366                                 

Gene name
adh-2
Definition
(GenBank) alcohol dehydrogenase, zinc-dependent
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
mbv  Mycoplasma bovis PG45
Pathway
mbv00010  Glycolysis / Gluconeogenesis
mbv00625  Chloroalkane and chloroalkene degradation
mbv00626  Naphthalene degradation
mbv01100  Metabolic pathways
mbv01110  Biosynthesis of secondary metabolites
mbv01120  Microbial metabolism in diverse environments
mbv01130  Biosynthesis of antibiotics
mbv01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mbv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MBOVPG45_0516 (adh-2)
  Lipid metabolism
   00071 Fatty acid degradation
    MBOVPG45_0516 (adh-2)
  Amino acid metabolism
   00350 Tyrosine metabolism
    MBOVPG45_0516 (adh-2)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MBOVPG45_0516 (adh-2)
   00626 Naphthalene degradation
    MBOVPG45_0516 (adh-2)
Enzymes [BR:mbv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MBOVPG45_0516 (adh-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 2-Hacid_dh_C TrkA_N AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ADR25260
Position
complement(593317..594357)
Genome map
AA seq 346 aa AA seqDB search
MKAFVVTEPKKWSVKEVDVPKPKYKEVLIEMETSGICHTDLHAANYDWLVEPKYPLIPGH
EGIGKVVALGEGCTRLKIGDRVALAWLHDACGYCEFCLTGRETLCPNQNMSAYTKDGSYA
EYAIGHEDYVGLVPEKLDIVTGAPVVCAGVTTYKSLKQTKAKAGNFVAVIGVGGLGQMAI
QYAKAMGLRPIGVDLQDEKCELALKSGAEYAFNSAKDPKFIEKIIEVTGGGVHAVVNTSV
HPSAAEQGMDMLRRGGRQVLVGLPAKDKHGKDDFKVSIFWSVLLERELAGSIVGTRQDLA
EALEYAAEGKVKSEVTKVVKLEEVADIFEKLQKGEFLGRAVIDFRK
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcttttgttgtaacagaacctaaaaaatgaagtgttaaggaagttgatgttcct
aaaccaaaatataaagaagttttaattgaaatggaaacttcaggtatctgtcatacagac
ttgcatgcggcaaattatgactgattagtagaacctaaatatccacttattccaggtcat
gaaggaattggaaaggtagttgcattaggggaaggatgcacacgtttgaaaattggtgat
agagttgctttagcatgattacatgatgcttgtggctactgtgaattttgtctaacaggt
agagaaacactttgtccaaatcaaaatatgtcggcttacactaaagacggatcatatgct
gaatatgcaattggtcatgaagattatgtaggattggttcctgaaaaattagatattgta
actggtgcaccagttgtttgtgcaggtgttacaacttataaatcattaaaacaaaccaaa
gcaaaagctggtaactttgtagctgttatcggtgtcggtggcttaggtcaaatggctatt
caatatgcaaaagctatgggactaagacctattggtgttgacttgcaagatgaaaaatgc
gaattagctcttaaatcaggtgcagaatatgcatttaactcagcaaaagatcctaaattt
attgaaaaaattattgaagtaactggcggaggtgtacacgctgtagttaatacatctgtt
cacccaagtgctgctgaacaaggtatggatatgcttcgtcgtggtggccgtcaagtatta
gttggtttaccagcaaaagataaacacggaaaagacgactttaaagtttcaattttctgg
tcagtattattagaacgtgagcttgctggctcaattgttggaactagacaagacttagca
gaagctttagaatatgctgctgaaggaaaagttaaatcagaagttactaaggttgtcaaa
ttagaagaagttgcagatatttttgaaaaacttcaaaaaggcgagttcttaggacgcgct
gttattgactttagaaaataa

DBGET integrated database retrieval system