KEGG   Mycoplasma bovis PG45: MBOVPG45_0529Help
Entry
MBOVPG45_0529     CDS       T01366                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mbv  Mycoplasma bovis PG45
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbv00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    MBOVPG45_0529 (glpK)
Enzymes [BR:mbv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     MBOVPG45_0529 (glpK)
Exosome [BR:mbv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MBOVPG45_0529 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
609112..610620
Genome map
AA seq 502 aa AA seqDB search
MEKYILTLDEGTTSARTLIVNKRGEIVAVEQAEFTQHFPKEGWVEHDAIEIWNTQRSTLV
QVLNKSKISPEQIDSIGITNQRETVVIWNKETGLPIYNAIVWQDQRTAEYCQSFNKEQLE
LVKEKTGLIINPYFSGTKVKWILDNVPNARELAAEGKLMFGTINTWLIYRLTGGKVFATD
HTNAQRTLLYNIHTNDWDNDLLELFNIPRSILPEIKSCSEDYGVTFPHLFSRDNASEIRI
TSSIGDQQSALFGQLCLEKGQSKITYGTGCFILTNTGSQIVKSNHGLLTTIAYSFKDKIL
YALEGSVMIAGAAVQWLRDNLKIVYSALETEWYAGQVNDDRRVYVVPSFTGLGSPYWDSY
SRGAIFGLDRGTKREHIVRATLEAIAYQANDVVSAMGKDMNDPIKIFKVDGGASNNKFMM
QFQSNISQSKVIKPVNIETTAMGAAFMAGLATGYWKSIDEIKDTYKVHFEITPEISATEA
NKLVKGWNVAVKRTFNWTKDIE
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaatacatattaactttagatgaaggtacaacaagtgctagaacattaatagtt
aataaaagaggcgaaattgttgctgttgaacaagcagaatttacacagcactttccaaaa
gaaggctgagttgaacacgatgcaattgaaatttggaacactcaacgttcaacattagtt
caggtgctcaataaatcaaaaattagtcctgagcaaattgattctattggtataacaaat
caaagagaaactgttgttatttgaaataaagaaacaggattgcctatttataatgcaatt
gtttggcaagatcaaagaacagctgaatattgtcaatcatttaacaaagagcaacttgaa
ttagtaaaagagaaaactggattaatcattaatccctatttctcaggtacaaaagtaaaa
tgaatactagacaatgtgcctaatgcaagagaattagctgctgaaggcaaactaatgttt
ggaactataaatacatgacttatttataggcttactggtggaaaagtgtttgcaactgac
cataccaatgcacaaagaacacttttatacaatattcacactaatgactgggataatgat
ctactagaattatttaatattcctagaagcatacttccagaaattaagtcttgtagtgaa
gattatggagttacattcccacatttattttctagagataatgcaagcgaaattagaata
acatcatcaattggtgaccaacaaagcgctctttttggccagttatgtttagaaaagggt
caatcaaaaattacatatggaactggttgcttcattctaacaaacactggaagccaaatt
gttaagtcaaatcatggtcttttaacaacaattgcatattcattcaaagacaaaatacta
tatgcattagaaggatctgtaatgatagccggtgcggctgtacaatgactaagggataac
ttaaaaattgtatatagtgccttagaaactgaatgatatgctggacaagttaatgatgac
agaagagtttatgtagtgccctcatttactggcttaggttctccatattgagactcatat
tcacgtggtgctatatttggtttggatagaggcacaaaaagagaacatattgttagggca
acactagaagctattgcttaccaggctaatgatgttgtaagcgctatgggtaaggatatg
aatgatcctattaaaatatttaaggttgatggtggagcatcaaataataaatttatgatg
caatttcagtcaaatatttctcaatcaaaagttattaaaccagtaaacatcgaaacaact
gcaatgggagctgcctttatggctggcttagctactggatactgaaagagcattgatgaa
ataaaagacacatacaaagttcactttgaaataacccctgagatttctgctaccgaagca
aataaattagttaaaggttgaaatgttgctgtaaaaagaacattcaactgaacaaaggac
atcgaatag

DBGET integrated database retrieval system