KEGG   Mycoplasma bovis PG45: MBOVPG45_0597Help
Entry
MBOVPG45_0597     CDS       T01366                                 

Definition
Holliday junction DNA helicase
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mbv  Mycoplasma bovis PG45
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mbv03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(693415..694011)
Genome map
AA seq 198 aa AA seqDB search
MILYRIGEIIHKHNSNIIFESQGIGYSLILPDPERVDVKQKCKLYLFEIKNEYQYATYAF
KDFKERLLFVDLISLNGIGPKAAFNILNFGFEKVSALIAEGNVEALIKIPYLNPRMARLI
VAELQAKWSKMISPKEVAKISVSTNTISEAKETLKMLGFKTKQIDNALAKVSTTDDIEKM
IEEAIKLISTQNYEPATA
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgattttatatagaataggtgaaataattcataaacataactcaaacataatatttgaa
agtcaagggataggttattcattgatactgccagatccagaaagggttgatgttaagcaa
aaatgcaagttgtatttatttgaaataaaaaatgaatatcagtatgcaacatatgctttt
aaagattttaaagaaagactactatttgttgatttaatatctcttaatggcattggacca
aaagcagcattcaatatattaaattttggattcgaaaaagtatcagcgttaatagcagaa
ggcaatgttgaagctctcattaaaattccatatcttaaccccagaatggcaaggctgatt
gtggctgaattacaggctaaatggtcaaaaatgattagtcctaaagaagttgcaaaaata
agtgtatcaaccaacacaatatctgaagctaaagaaacacttaagatgctaggttttaaa
actaagcaaattgataatgcattagcaaaggtgtcaacaactgatgatattgaaaaaatg
attgaagaagcaattaaattaatttctactcaaaactatgaaccagctactgcttag

DBGET integrated database retrieval system