KEGG   Mycoplasma bovis PG45: MBOVPG45_0597Help
Entry
MBOVPG45_0597     CDS       T01366                                 

Definition
Holliday junction DNA helicase
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mbv  Mycoplasma bovis PG45
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mbv00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MBOVPG45_0597
Enzymes [BR:mbv01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     MBOVPG45_0597
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(693415..694011)
Genome map
AA seq 198 aa AA seqDB search
MILYRIGEIIHKHNSNIIFESQGIGYSLILPDPERVDVKQKCKLYLFEIKNEYQYATYAF
KDFKERLLFVDLISLNGIGPKAAFNILNFGFEKVSALIAEGNVEALIKIPYLNPRMARLI
VAELQAKWSKMISPKEVAKISVSTNTISEAKETLKMLGFKTKQIDNALAKVSTTDDIEKM
IEEAIKLISTQNYEPATA
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgattttatatagaataggtgaaataattcataaacataactcaaacataatatttgaa
agtcaagggataggttattcattgatactgccagatccagaaagggttgatgttaagcaa
aaatgcaagttgtatttatttgaaataaaaaatgaatatcagtatgcaacatatgctttt
aaagattttaaagaaagactactatttgttgatttaatatctcttaatggcattggacca
aaagcagcattcaatatattaaattttggattcgaaaaagtatcagcgttaatagcagaa
ggcaatgttgaagctctcattaaaattccatatcttaaccccagaatggcaaggctgatt
gtggctgaattacaggctaaatggtcaaaaatgattagtcctaaagaagttgcaaaaata
agtgtatcaaccaacacaatatctgaagctaaagaaacacttaagatgctaggttttaaa
actaagcaaattgataatgcattagcaaaggtgtcaacaactgatgatattgaaaaaatg
attgaagaagcaattaaattaatttctactcaaaactatgaaccagctactgcttag

DBGET integrated database retrieval system