KEGG   Mycoplasma bovis PG45: MBOVPG45_0650Help
Entry
MBOVPG45_0650     CDS       T01366                                 

Gene name
tkt
Definition
(RefSeq) transketolase (EC:2.2.1.1)
  KO
K00615  
transketolase [EC:2.2.1.1]
Organism
mbv  Mycoplasma bovis PG45
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mbv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MBOVPG45_0650 (tkt)
   01230 Biosynthesis of amino acids
    MBOVPG45_0650 (tkt)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MBOVPG45_0650 (tkt)
  Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    MBOVPG45_0650 (tkt)
Enzymes [BR:mbv01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     MBOVPG45_0650 (tkt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(741990..743936)
Genome map
AA seq 648 aa AA seqDB search
MNINQKVVASMQAIALDSINNAGGGHIGSAIDICPIMYAVVAKHMKISADHPKWISRDRL
ILSAGHASMSFYSMMHFLGLLSLDEMKNHKRKHSKTPSHPETDAFDFVDASTGPLGQGIA
MGVGMAIAEKKMSLKINKGNTKVIDNYTYVIAGDGCLQEGIAHEALQIASVMKLNKFILI
HDYNKIQLDTKVSDVSNVDLLAYFKALNFNVIEINEASYDNIDKAITEAKKSDRPTYIMV
HNIIAPFTPFENTTKGHHGILNSEQTIEFKKAIGLENKAPFEYDSDVYEYGRIIIANKAK
SYEEWLVELDNHKKQFPWIHSLLLETINNETNYDFSNILVKQDDLAIRDYFKAFSEIVDF
SYPFLIGGGADVGSSTKVRFADSILDYGQRIDYGVREFAMTAINNGINLYGGLKTADSTF
LAFSDYAKGALRLGGIMKLPAVHLYSHDSYLVGDDGPTHQPIEQVTVLRSIPNLLVIRPC
DKYELVMGLNYAYNNTSTQVAIIGTRQPIKTMHSSKFSEFMAASLVYENKEFDISILSSG
SEVELAYKTAVELKNHGIIANVISVPVLQKLVDNDELAIKLKLDKKPMFAIEASNDPLWY
KLSKYNKIDGHFASEYGFSDKGNVVYDSMGFNVNSIVDKVKQFLSKNA
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgaatattaatcaaaaagttgttgcatctatgcaagcaatagctttagactcaataaat
aatgctggtggaggccatattggatctgcaattgacatttgtccaataatgtatgctgtt
gttgctaagcatatgaaaattagtgctgatcatccaaaatgaattagcagagatagacta
attttatccgctggtcatgcatcaatgtcattttatagtatgatgcactttttaggattg
ctttcattagatgaaatgaaaaaccataaaagaaagcattcaaaaacgccatcacatcct
gaaactgatgcatttgattttgtcgatgcttcaactggtccattaggacaagggattgca
atgggtgttggtatggcaatagctgagaagaaaatgtcgcttaaaatcaataaaggcaac
actaaggttattgataactatacatatgttattgcaggtgatgggtgcttacaagaaggt
attgcgcatgaggcgctgcaaattgctagtgttatgaaactaaataaatttattttgatt
catgactataataaaattcagctagatacaaaggtttctgacgtaagtaatgttgactta
ttagcctattttaaagccttaaacttcaatgtaattgaaattaatgaagcttcatatgat
aatattgataaggcaattactgaagctaaaaagtctgatagaccaacttatattatggtg
cacaatataatagccccatttactccatttgaaaacaccacaaaaggtcatcacggaatt
ttaaacagtgaacaaacaatagaatttaaaaaggcaattggattagaaaataaagcacct
tttgaatatgattctgatgtatatgaatatggcagaattataattgctaataaggcaaaa
agctacgaagaatgattagttgagttagataatcataaaaaacaatttccgtgaattcat
tcattattattagaaactattaataacgagacaaattatgatttttcaaacatccttgta
aaacaggatgatttggcaattagggactattttaaggcatttagcgaaatagttgatttt
tcatatccatttttaataggtggtggcgctgatgtgggttcatcaactaaggtaaggttc
gctgattcaatacttgattatggtcaaagaatagactatggtgtaagagaatttgcaatg
actgcaattaataatggcattaatttatatggtggattaaaaactgctgattcaactttt
ttagcattttcggattatgctaagggagcactaagattaggtggaataatgaaacttcct
gcagtgcatttatattcacatgattcttatttagttggagatgatggtcctactcatcaa
ccaatagaacaagtaactgttttaagatctattccaaatttattggtaattcgcccttgt
gataaatatgaactagtaatgggattaaattatgcatataataatacaagtacccaagtt
gcaataataggaactagacaaccaattaaaacaatgcactcaagtaagttttctgaattt
atggcagctagtttggtatatgaaaacaaagagtttgatatatcaattctatcatcaggt
tctgaagttgaattagcctataaaacagccgtagaattaaaaaatcacggcataattgct
aatgttatatctgttccagtgttacaaaaattagttgataatgatgaattagctataaaa
cttaaattagataaaaaacctatgtttgcaatagaagcatcaaacgatccactatgatat
aaattaagtaaatataacaaaatagatggtcattttgcttctgaatacggattttctgac
aaaggaaatgttgtatatgattctatgggatttaatgtcaatagcatagttgataaagta
aaacaattcttgtcaaaaaatgcttaa

DBGET integrated database retrieval system