KEGG   Mycoplasma bovis PG45: MBOVPG45_0650Help
Entry
MBOVPG45_0650     CDS       T01366                                 

Gene name
tkt
Definition
transketolase (EC:2.2.1.1)
Orthology
K00615  
transketolase [EC:2.2.1.1]
Organism
mbv  Mycoplasma bovis PG45
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mbv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MBOVPG45_0650 (tkt)
   01230 Biosynthesis of amino acids
    MBOVPG45_0650 (tkt)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MBOVPG45_0650 (tkt)
  Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    MBOVPG45_0650 (tkt)
Enzymes [BR:mbv01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     MBOVPG45_0650 (tkt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(741990..743936)
Genome map
AA seq 648 aa AA seqDB search
MNINQKVVASMQAIALDSINNAGGGHIGSAIDICPIMYAVVAKHMKISADHPKWISRDRL
ILSAGHASMSFYSMMHFLGLLSLDEMKNHKRKHSKTPSHPETDAFDFVDASTGPLGQGIA
MGVGMAIAEKKMSLKINKGNTKVIDNYTYVIAGDGCLQEGIAHEALQIASVMKLNKFILI
HDYNKIQLDTKVSDVSNVDLLAYFKALNFNVIEINEASYDNIDKAITEAKKSDRPTYIMV
HNIIAPFTPFENTTKGHHGILNSEQTIEFKKAIGLENKAPFEYDSDVYEYGRIIIANKAK
SYEEWLVELDNHKKQFPWIHSLLLETINNETNYDFSNILVKQDDLAIRDYFKAFSEIVDF
SYPFLIGGGADVGSSTKVRFADSILDYGQRIDYGVREFAMTAINNGINLYGGLKTADSTF
LAFSDYAKGALRLGGIMKLPAVHLYSHDSYLVGDDGPTHQPIEQVTVLRSIPNLLVIRPC
DKYELVMGLNYAYNNTSTQVAIIGTRQPIKTMHSSKFSEFMAASLVYENKEFDISILSSG
SEVELAYKTAVELKNHGIIANVISVPVLQKLVDNDELAIKLKLDKKPMFAIEASNDPLWY
KLSKYNKIDGHFASEYGFSDKGNVVYDSMGFNVNSIVDKVKQFLSKNA
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgaatattaatcaaaaagttgttgcatctatgcaagcaatagctttagactcaataaat
aatgctggtggaggccatattggatctgcaattgacatttgtccaataatgtatgctgtt
gttgctaagcatatgaaaattagtgctgatcatccaaaatgaattagcagagatagacta
attttatccgctggtcatgcatcaatgtcattttatagtatgatgcactttttaggattg
ctttcattagatgaaatgaaaaaccataaaagaaagcattcaaaaacgccatcacatcct
gaaactgatgcatttgattttgtcgatgcttcaactggtccattaggacaagggattgca
atgggtgttggtatggcaatagctgagaagaaaatgtcgcttaaaatcaataaaggcaac
actaaggttattgataactatacatatgttattgcaggtgatgggtgcttacaagaaggt
attgcgcatgaggcgctgcaaattgctagtgttatgaaactaaataaatttattttgatt
catgactataataaaattcagctagatacaaaggtttctgacgtaagtaatgttgactta
ttagcctattttaaagccttaaacttcaatgtaattgaaattaatgaagcttcatatgat
aatattgataaggcaattactgaagctaaaaagtctgatagaccaacttatattatggtg
cacaatataatagccccatttactccatttgaaaacaccacaaaaggtcatcacggaatt
ttaaacagtgaacaaacaatagaatttaaaaaggcaattggattagaaaataaagcacct
tttgaatatgattctgatgtatatgaatatggcagaattataattgctaataaggcaaaa
agctacgaagaatgattagttgagttagataatcataaaaaacaatttccgtgaattcat
tcattattattagaaactattaataacgagacaaattatgatttttcaaacatccttgta
aaacaggatgatttggcaattagggactattttaaggcatttagcgaaatagttgatttt
tcatatccatttttaataggtggtggcgctgatgtgggttcatcaactaaggtaaggttc
gctgattcaatacttgattatggtcaaagaatagactatggtgtaagagaatttgcaatg
actgcaattaataatggcattaatttatatggtggattaaaaactgctgattcaactttt
ttagcattttcggattatgctaagggagcactaagattaggtggaataatgaaacttcct
gcagtgcatttatattcacatgattcttatttagttggagatgatggtcctactcatcaa
ccaatagaacaagtaactgttttaagatctattccaaatttattggtaattcgcccttgt
gataaatatgaactagtaatgggattaaattatgcatataataatacaagtacccaagtt
gcaataataggaactagacaaccaattaaaacaatgcactcaagtaagttttctgaattt
atggcagctagtttggtatatgaaaacaaagagtttgatatatcaattctatcatcaggt
tctgaagttgaattagcctataaaacagccgtagaattaaaaaatcacggcataattgct
aatgttatatctgttccagtgttacaaaaattagttgataatgatgaattagctataaaa
cttaaattagataaaaaacctatgtttgcaatagaagcatcaaacgatccactatgatat
aaattaagtaaatataacaaaatagatggtcattttgcttctgaatacggattttctgac
aaaggaaatgttgtatatgattctatgggatttaatgtcaatagcatagttgataaagta
aaacaattcttgtcaaaaaatgcttaa

DBGET integrated database retrieval system