KEGG   Mycoplasma bovis PG45: MBOVPG45_0783Help
Entry
MBOVPG45_0783     CDS       T01366                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
mbv  Mycoplasma bovis PG45
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mbv03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(906740..907327)
Genome map
AA seq 195 aa AA seqDB search
MEIKTINELTKKLISIPTITKKQAEKLSDYILKASKEEISSTLEFILEAKDKIGFCEKCN
FIVENGKCVNCDRFNLWNTLIIVESVASVKKIFDTDFYNGYFYVLPYLLSVVPKDAKIDF
NYEHLVKFIKLKRINEVIIVLSPTIEGQMTTAQLMQICREIDVKATRAAVGLPLNSNIEY
IDEFTIKQAIENRTK
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggaaattaaaactattaatgagttaaccaaaaaattaatatccattccaacaataaca
aagaagcaggccgaaaaactttcagactatattctcaaagcatcaaaagaagaaataagt
agtactttagagtttatattagaagctaaagacaaaattggattttgtgaaaaatgcaat
tttatagtcgaaaacgggaaatgtgtaaactgtgacagatttaatttgtgaaacaccttg
attattgttgaaagcgtcgccagtgtcaaaaaaatatttgatacagacttttataatggt
tatttttatgtgcttccttacttattgtcagttgttccaaaagatgccaaaattgacttt
aattatgagcacttggttaagttcatcaaactgaaaagaataaatgaagtaataattgtt
ctaagtccaacaattgaggggcaaatgacaacagcacaattaatgcaaatttgcagagag
atcgatgtaaaagcaactagagctgctgttggattacctttaaattctaatattgaatat
attgacgaattcactattaaacaagccatagaaaacagaacaaaataa

DBGET integrated database retrieval system