KEGG   Mycoplasma bovis PG45: MBOVPG45_0868Help
Entry
MBOVPG45_0868     CDS       T01366                                 

Definition
RecD/TraA family protein
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
mbv  Mycoplasma bovis PG45
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mbv00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MBOVPG45_0868
Enzymes [BR:mbv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     MBOVPG45_0868
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1000974..1003244)
Genome map
AA seq 756 aa AA seqDB search
MIVSSNSNQELIKLKGKFLTIKWSGADSSGTRELWIFESISDKERYFIYSSKQGIKSSCF
YDIEIKAKSFKRSKYQNQSYELISCKIVSPDNDSDVEKMLVSNVSGLGVKGIQKIKKELN
LSSIKELFKDVTVVQNVLKTAVYENLKAFIESFDQKDYDFFYEHGLLKLYDKLHTKFENK
DFVSRYKNGGDPYELYVDHWIDFKLVDTFASIINPELDAYKKVRAFTYKILRTNFSSLCS
MYYDDTPLYRQLWNFYDLYRNDNSDNSTLFEQSYIVSLLGILLGKYSIPNDLIIESLKIM
IQRGEIYFDNLSKRLSLNEIYEQELFISKKLIKIRDQEIKKQIIPLPSQNLSNEQKEAYS
SALNNPISVITGYPGTGKSYLITYIVETLLEGKYYKKKDIAVLTPTGRASTILTYKTGIE
AKTIHSFLKLSKPDEDESFIESFEKENPVKVVVVDEFSMVSLPIFYELLKICKSIEKLIL
VGDRDQLPCIGKGNLLEDIINSQKFPTFVLKEVHRTDKIDIFDHFISINENKVPNLNTAN
VKFIEQNGTQFLNNIVRIYEEKTNKYSIDNVIILLPSYLELGQPGINEVNKRLQDWNVKR
TGTKKNLFIYNNLTLFIGDRVIQTINDYDKNVFNGEIGIVEEISSNNRNGHIIVAFGNGK
KIKYTKSEILENLSLAYAITVHKFQGSEASCVIFGILRNRVEHMFTKKFMYTAVSRAKEE
LLLLGSMDLYAQKIQSPNADLKYYTNLKMLIEKEAE
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atgattgtatcaagcaacagtaatcaagaattaattaaattaaaaggaaagtttttaaca
atcaaatgaagcggggctgacagtagtgggacaagagagctctggatttttgagtctatt
tctgacaaagaacgttattttatttatagtagtaaacaaggaattaaaagttcttgtttt
tatgatattgaaattaaagcaaaatcatttaaacgttctaagtatcaaaaccaatcatac
gaattgattagttgcaaaattgttagtcctgataacgacagtgatgttgaaaaaatgcta
gtaagtaatgttagcggcctaggggtaaaagggatccagaaaataaaaaaagaattaaac
ttatcaagtataaaagagttatttaaggatgttactgttgtccaaaatgtgcttaaaaca
gcggtatatgaaaatttaaaggcgtttattgaaagtttcgatcaaaaagattatgacttt
ttttatgaacatggtcttttgaagctgtatgacaaactgcatacaaaatttgaaaataaa
gattttgttagcaggtacaaaaatggtggagatccatatgaattatatgttgatcactga
attgattttaaacttgtagatacttttgcttcgattattaatcctgagttagatgcttac
aaaaaagtaagagcgtttacttacaaaatattaagaaccaattttagtagtctttgttca
atgtactacgatgacacaccgctttataggcaattgtgaaatttttatgatttatataga
aatgataattctgacaatagtacactttttgaacaatcgtacattgtttcattattaggt
atattgttgggaaaatatagtattcccaatgatttaatcattgagtctcttaaaataatg
attcaacgtggtgaaatatattttgataacttatctaaaagactttcattgaatgaaatt
tatgaacaagaactttttattagcaaaaaacttataaaaataagagatcaagaaataaag
aaacaaattattcccttaccatcacaaaatttatcaaacgaacaaaaggaagcttattct
agtgcattaaataatccgatctctgtaataactggctatccaggaacaggaaaaagttat
ttaatcacttatattgtagagacattattagagggtaaatattataagaaaaaagacatt
gctgttttaactccaacaggtagagcatctaccatattaacttataaaacaggtatagaa
gctaaaacaattcatagttttttaaaactttcaaagcctgatgaagatgaatcattcatt
gaatcgtttgaaaaagagaacccagtcaaagttgttgtggttgatgagttttcgatggtc
agtttaccaatattttatgaattattaaagatatgcaaaagcattgaaaaattaattctt
gtgggtgatagagaccaattaccatgtattggaaaagggaacttattagaagatataata
aacagtcagaagtttccaacatttgtattaaaagaagtgcatagaacagataaaattgac
atatttgaccattttatatctataaacgaaaacaaggttccaaatttaaatactgctaat
gtcaagtttattgaacaaaatggcacccagtttttaaataacattgtcagaatatatgaa
gaaaagactaataagtattctattgataatgtaataattttacttccttcatatttagaa
ttaggtcagccaggaataaatgaagttaataagagacttcaggattgaaatgtcaaaaga
acaggcacaaagaaaaatttatttatttacaataatttaaccttgtttataggtgacaga
gttattcaaacaataaatgattacgataaaaacgtgttcaatggtgaaataggaattgtt
gaagagataagttcgaacaacagaaatggacatataattgttgcatttggaaatggcaag
aagattaaatatacaaaaagcgaaattttagagaatttatcgttagcatatgctataaca
gtgcataagtttcaagggtcagaagcaagctgtgttatattcgggattttaaggaataga
gttgaacatatgtttactaaaaaatttatgtatacagctgtttcaagggcaaaagaggaa
ttattgctccttgggtcaatggatttatatgctcaaaaaattcaatccccgaatgctgat
ttaaaatactacacaaacttgaaaatgcttattgagaaagaggcagaataa

DBGET integrated database retrieval system