KEGG   Methylococcus capsulatus: MCA0345Help
Entry
MCA0345           CDS       T00205                                 

Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
mca  Methylococcus capsulatus
Brite
Enzymes [BR:mca01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     MCA0345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
346923..347954
Genome map
AA seq 343 aa AA seqDB search
MFTLRLLTGALALAGVSAAVADWQALPAKAPEPAANPSTPAKVELGKMLYLDPRLSSTGT
VSCNSCHNVMLGGEDNRGGSVGVHGQVGGRSAPTVWNAAFNSVQFWDGRAPSLEAQAKGP
VTNPIEMGMKSWDDVVARLKAIPGYPEAFAAAFGSGDAVTADNAAKAIAAYERTLITPNS
PYDRYVGGDKTALTEQQVRGMNTFAETGCSNCHSGPAFNGPTLPEGTPFFMKFPTFENGM
FEAKYGFSRDKGRAEVTKKTEDEHLFKVPTLRNVALTAPYFHNGKVKTLDEAVRVMAKLQ
LNKDLSDQQVADVVAFLNALTGEFPKQQMPQLPGLPNGTFDYD
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgttcactctacgtttgctgaccggcgccctggccctggccggagtgtcggcggcggtt
gccgactggcaggcactgcccgccaaggctcccgaacctgcggccaatccgagcaccccg
gccaaggtggaactgggcaagatgctttacctggacccgcgcctgtcctccaccggcacg
gtgtcgtgcaattcctgccacaacgtgatgctcggcggcgaagacaaccgcggtggttcg
gtcggcgtccacggccaggtcggcggccgcagcgcgccgacggtctggaacgccgccttc
aattccgtgcagttctgggacggccgcgcgcccagcctggaagcgcaggccaagggaccc
gtgaccaaccccatcgagatgggcatgaagagctgggacgacgtcgtggcccggctcaag
gccattccgggttatcccgaagccttcgccgctgccttcggcagcggtgacgcggtgacg
gcggacaatgccgccaaggccatcgccgcctatgagcgcactttgatcacgccgaacagc
ccctacgacaggtacgtcggcggcgacaagaccgccctgaccgaacagcaggtgcggggc
atgaacaccttcgccgagaccggctgttcgaactgccacagcggcccggcgttcaatggt
ccaactctgccggagggaacgccgttcttcatgaagttcccgactttcgagaacggcatg
ttcgaggcgaaatacggattctcccgggacaagggccgggccgaggtcaccaagaagacc
gaggacgaacatttgttcaaggtgccgaccctgcgcaacgtcgccctgactgcgccgtat
ttccacaacgggaaggtcaagacgctggacgaggcggtgagggtgatggccaagctgcag
ctcaacaaggacttgagcgatcagcaggtcgccgacgtggtcgcgttcctgaatgcgttg
accggcgaattccccaagcagcagatgccgcagctgcccggtttaccgaacggaaccttc
gattacgactaa

DBGET integrated database retrieval system